(data stored in ACNUC9435 zone)

EMBL: CP000031.PE543

CP000031.PE543       Location/Qualifiers
FT   CDS_pept        complement(548102..548686)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0552"
FT                   /product="phosphoglycerate mutase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0552"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93868"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LVZ2"
FT                   /protein_id="AAV93868.1"
FT                   /translation="MRRLALLRHGHTDWNRAGRIQGRSDIPLDDAARHDLGALALPAPW
FT                   DRATLWSSPLSRAVETAKLVAGHTPRNAPALTEMNWGDWEGQRGRDLLDTPGSGYRHIE
FT                   DWGWDFRPPAGESPAEVWTRIDPWLAGLTGDSVAVCHIGIMRVILARAHGWNFDGIPPF
FT                   KVKRNRLFVVSLDPLAPSGEPVRLIPREARP"
     atgagacgcc tcgcccttct gcgccatggt cacaccgact ggaaccgcgc cggtcgcatc        60
     cagggccgca gcgacatccc gctggacgac gccgcacggc acgacctggg cgcgctggcc       120
     ctgcccgcgc cctgggatcg cgcgacgctc tggtccagcc cgctctcgcg cgcggtggaa       180
     accgccaaac tggtggccgg gcacacgccc cgcaacgcgc ctgctctgac cgagatgaac       240
     tggggcgact gggaggggca gcgcgggaga gacctgctcg acacgcccgg cagcggctat       300
     cggcatatcg aggactgggg ctgggatttc cgcccgcccg caggggaaag cccggcagag       360
     gtctggaccc ggatcgaccc ctggctggcc gggttgaccg gcgacagcgt cgcggtctgc       420
     catatcggca tcatgcgggt catcttagct cgcgcccatg gctggaattt cgacggcatc       480
     ccgcccttca aggtcaagcg caaccggctt ttcgtcgttt cgctcgaccc tctggcgccc       540
     tcgggcgaac cagtgcggct gatcccgcgc gaggcccgcc catga                       585
//

If you have problems or comments...

PBIL Back to PBIL home page