(data stored in ACNUC7421 zone)

EMBL: CP000031.PE546

CP000031.PE546       Location/Qualifiers
FT   CDS_pept        complement(551006..552220)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0555"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to GB:BAB50184.1"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0555"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93871"
FT                   /db_xref="GOA:Q5LVY9"
FT                   /db_xref="InterPro:IPR016683"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LVY9"
FT                   /protein_id="AAV93871.1"
FT                   /translation="MQGESRTVDTGRAARVMLYSHDTFGLGHLRRSRALAAAITQADPS
FT                   ASALILTGSPVAGRFTFPRRVDHVRLPGVTKRADGSYASQTMGMGIDEVTDLRSGLIRG
FT                   AAERYDPDILIVDKEPTGFRGELLPTLDCLQRRGRARLVLGLRDVLDEPEVLAAEWARK
FT                   GAVAATERFYDEIWVYGLRSVYDPTAGLPLSPEAQARMHWTGYLRRDLGPVGTPPHQPY
FT                   VLITPGGGGDGEAMVNLVLSAYEQDPTLSPRAVLVYGPFLSGDTRAEFERRVAALNGRV
FT                   TAVGFESEIETLFAGAAGVVCMGGYNTFCEVLSFDQRAVIVPRTVPRLEQWIRASRAEE
FT                   LGLVRMLEESRDGLTPETMIQAIRNLPNQPLPSQAIGEGLLDGLDHVTRRVRALLSKTS
FT                   HQAAE"
     atgcagggcg agagcaggac agtcgacacc ggccgagcgg cgcgtgtgat gttgtacagc        60
     cacgatacgt tcgggctggg ccatcttcga cgtagccggg cgctggccgc cgcgatcacc       120
     caggccgacc cctcggcctc ggcgctgatc ctgaccggct cgccggtggc ggggcgtttc       180
     acctttccgc gccgggtcga ccacgtacgc ctgcctggcg tgaccaagcg cgccgacggc       240
     tcttatgcct cgcagacgat ggggatgggc atcgacgagg tgaccgacct gcgcagcggt       300
     ctgatccgcg gcgccgcaga acggtatgac cccgatatcc tgatcgtcga caaggaaccg       360
     accggctttc gcggcgagct gctgccgacg ctcgactgtc tgcaacggcg cgggcgtgcc       420
     cggctggtgc tgggcctgcg cgacgtgctg gacgagcccg aggtgctggc tgccgaatgg       480
     gcgcgcaagg gtgccgtggc ggcgaccgaa cgcttttatg acgagatctg ggtttacggg       540
     ctgcgctcgg tctatgaccc gacggcgggc ctgcccctca gccccgaagc gcaggcgcgc       600
     atgcactgga ctggctatct gcgccgcgat ctggggccgg tgggcacccc gccgcatcaa       660
     ccctatgtgc tgatcacccc cggtggcggt ggcgatggcg aggcgatggt caatctggtt       720
     ttgtccgcct atgaacagga cccgaccctg tcgccacgcg cggtgctggt ctatggcccc       780
     ttcctgtcgg gcgacacccg cgccgagttc gaacggcgcg tggcggcgct gaacgggcgg       840
     gtgaccgcgg tcgggttcga aagcgagatc gaaacgctct ttgccggggc cgccggcgtt       900
     gtgtgcatgg gcggttacaa caccttttgc gaggtgctgt cctttgatca gcgcgcggtg       960
     atcgtgccgc gcaccgtgcc gcgtctggaa cagtggatcc gcgccagccg cgccgaagag      1020
     ctgggcctgg tgcggatgct ggaggaaagc cgcgacgggc tgacgcccga gaccatgatt      1080
     caggccattc gcaacctgcc caaccagccg ctgcccagcc aggccatcgg cgagggtctg      1140
     ctggacgggc tcgaccatgt cacccgccgc gtccgcgcgc tgctgagcaa gaccagccat      1200
     caggcggcgg aatga                                                       1215
//

If you have problems or comments...

PBIL Back to PBIL home page