(data stored in ACNUC9435 zone)

EMBL: CP000031.PE548

CP000031.PE548       Location/Qualifiers
FT   CDS_pept        553643..556090
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0557"
FT                   /product="mechanosensitive ion channel family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0557"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93873"
FT                   /db_xref="GOA:Q5LVY7"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR011014"
FT                   /db_xref="InterPro:IPR011066"
FT                   /db_xref="InterPro:IPR023408"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LVY7"
FT                   /protein_id="AAV93873.1"
FT                   /translation="MPSGQALRISRTCRLNAHPRFDRLWRSPTPIQVSAMIVAFRLFLA
FT                   CLGLFLCLSSPLAAQVSLYSGIAGTSDESAGGDLAEAIRAASEAGASVIVIDSAGRVAA
FT                   AGTEAGAVETARVDPMGEASQLMKAQEKVSDFIGALRSRLEALPYSIFEVQYILRQTSP
FT                   DGRIATYAEVLAINLVLLLIGRWMSIEIYGKRIARKHVVSRIREAPRGYREKMPFLVFR
FT                   FVMGVGATLFAMVFAFIIGFLIFGPMQDLSIQFTVTAIFTAYFLARTASDLWRMVLSPY
FT                   LSQYRLPPFSDRDAKRLYLWASLLATYDISSELFSTWVADFGLNYNVYAMVYGVLTGVG
FT                   ALGNVLMVLFNGRAISNAIRGGRTKDEVSWILRLVSVAWAPVVLFYMVFGWLQLAFDLV
FT                   LERPVHIPLMAGTYGIFMSVVVAYGAMNYLLERYFDRTRQVKELNAALAEAEAAEDLSM
FT                   TGVSAQRHHIATFEDLARRVAGILAFVVGTYALVLIWNPEMDWTGDLPIDRALDVMVII
FT                   FLGYIVFHFFRIWIDSKIAEETVDVPEGELGDEGGGTSASRLATLLPLFRGAILAVVVV
FT                   SIVLIALMEVGINVSPLFAGAGVVGLAVGFGSQTLVRDIFSGAFFLVDDAFRKGEYIDI
FT                   GDVKGTVEKISVRSFQLRHHLGALHTIPFGEIKVLTNFSRDWVIMKLPLRVTYDTDVEK
FT                   VRKLIKNLGQELLSDPVIGDNFIQPLKSQGVIEMQDSAMIIRVKFMTKPGDQWLVRKRV
FT                   YQDIRELFAREGIKFAHREVTVRLADGQEAAKMTPQQREAVTGAVQAAIDEDVLDDMMD
FT                   DDR"
     gtgccgtccg ggcaggcgct ccggataagc cgcacttgcc gtttgaatgc acaccctcgc        60
     ttcgataggc tgtggcgaag cccaacgccc atacaggttt ccgcaatgat tgtagccttt       120
     cgtcttttcc ttgcctgtct tggcttgttt ctgtgtctgt cgtcaccgct ggcggcgcag       180
     gtctcgcttt attcagggat cgccggaacc tcggacgaga gcgccggcgg cgatctggcc       240
     gaggccattc gcgccgcctc cgaggccggg gcctcggtca tcgtgatcga cagcgccgga       300
     cgggtggccg cagccggaac cgaagcgggc gcggttgaaa ccgcccgcgt cgatccaatg       360
     ggcgaggcgt cacagctgat gaaggcgcag gaaaaggtgt ccgacttcat cggggcgctg       420
     cgctctcggc tcgaggcact gccctattcc atcttcgagg tgcaatacat cctgcgccag       480
     accagccccg acgggcggat cgcgacctat gccgaggtgc tggcgatcaa cctggtgctg       540
     ctgctgatcg ggcgctggat gtcgatcgag atctacggca agcgcatcgc acgcaaacat       600
     gtggtgtcgc ggatccgcga ggcgccgcgc ggctatcggg aaaagatgcc gttcctggtg       660
     ttccgcttcg tgatgggggt gggggcgacc ctgttcgcca tggtctttgc cttcatcatc       720
     ggcttcctga tctttggacc tatgcaggat ctgtcgatcc agttcacggt caccgcgatc       780
     tttaccgcct atttcctggc ccggaccgcc tcggacctgt ggcggatggt gctgtcgccc       840
     tatctgagcc agtaccggct gccgcccttt tcggaccgcg acgccaagcg gctgtatctc       900
     tgggcgtcgc tgctggcgac ctatgatatc tccagcgagc tgttctcgac ctgggtcgcc       960
     gatttcggcc tgaactacaa tgtctatgcc atggtctatg gcgtgctgac cggggtcggc      1020
     gccctaggca atgtgctgat ggtgctgttc aacgggcggg cgatctcgaa tgccatacgc      1080
     ggcggccgga ccaaggacga ggtgtcgtgg atactgcggc tggtgtcggt cgcctgggcg      1140
     ccggtggtgc tgttctacat ggtgttcggc tggctgcaac tggccttcga tctggtgctg      1200
     gagcgtccgg ttcatatccc gctgatggct ggcacctatg gcatcttcat gtcggtcgtg      1260
     gtcgcttatg gcgcgatgaa ctacctgctc gagcgctatt tcgaccggac ccggcaggtg      1320
     aaggagttga acgccgccct ggccgaggca gaggcggcgg aagacctgtc catgacgggg      1380
     gtcagcgcgc agcggcatca catcgccacg ttcgaggacc tggcccgccg ggtagccggt      1440
     atcctggcct ttgttgtggg cacctatgcg ctggtcctga tctggaaccc cgagatggac      1500
     tggaccggtg atctgcccat cgaccgggcg ttggatgtga tggtgatcat cttcctgggc      1560
     tatatcgtgt ttcacttctt ccggatctgg atcgacagca agattgccga agagacggtg      1620
     gatgtgcccg agggagagct cggcgacgag ggcggcggaa ccagcgctag ccgcctggcg      1680
     acgctgctgc cgctgttcag gggcgcgatc ctggcggttg tggtggtttc gatcgtgctg      1740
     atcgcgctga tggaagtggg gatcaatgtc agcccgctgt ttgccggtgc cggcgtggtc      1800
     ggtctggcgg tgggcttcgg ctcgcaaacg ctggtgcggg atatcttttc gggtgcgttc      1860
     tttctggtcg atgacgcgtt ccgcaaggga gagtatatcg acatcggcga tgtgaagggc      1920
     acggtcgaaa aaatctcggt ccgttccttc cagctgcgcc accatctggg agcgctgcac      1980
     acgatcccct ttggtgagat caaggtgctg accaacttct cgcgtgattg ggtgatcatg      2040
     aaactgccgc tgcgggtgac ctatgacacc gacgtggaaa aggtgcgcaa gctgatcaaa      2100
     aaccttgggc aggagctgct gagcgatccg gtgatcggcg acaatttcat ccagccgctg      2160
     aaaagtcagg gtgtgatcga gatgcaggat tcggcgatga tcatccgggt caagttcatg      2220
     accaagccgg gcgatcaatg gctggtgcgc aagcgggttt atcaggacat tcgtgagctt      2280
     tttgcccgcg aaggcatcaa gttcgcccat cgcgaggtca cggtacgtct ggccgacggc      2340
     caggaggctg ccaagatgac accacagcag cgtgaggcgg taacgggtgc ggtccaggcc      2400
     gccatcgacg aggatgtgtt ggacgacatg atggatgacg accgctga                   2448
//

If you have problems or comments...

PBIL Back to PBIL home page