(data stored in ACNUC7421 zone)

EMBL: CP000031.PE550

CP000031.PE550       Location/Qualifiers
FT   CDS_pept        complement(557329..558357)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0559"
FT                   /product="oligopeptide ABC transporter, permease protein"
FT                   /note="identified by similarity to SP:P42062"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0559"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93875"
FT                   /db_xref="GOA:Q5LVY5"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LVY5"
FT                   /protein_id="AAV93875.1"
FT                   /translation="MAILRYAFYRFGTMLMTLLVVSVLVFAIINLPPGDYLSNQIAELK
FT                   ASGQSAGVAKAEFLRKEYALDRPVWQQYMIWMGFMPGPHGFSGLIQGNFGWSFEFDRPV
FT                   SEIVGDSLWLTVLVNMAAIVFVYATALPLGVIAAAKARTWADYTSAFVGYLGLATPNFL
FT                   LALILYYYGRKYLDIPIGGLMDPAFEGQPMSWAKIQSVLVHLIVPTIVIGTAGASAMMQ
FT                   RLRANMLDELGKPYVETAIAKGMAPSRMLAKYPLRVAFNPFVADIGNLLPSMVSGSVLV
FT                   SVVMGLQTIGPTLLTALKSQDMFLSGFVLMFVALLTLIGTMISDILLVMLDPRIRYEGR
FT                   DA"
     atggcaatcc tgcgctacgc attttaccgg ttcggaacca tgctgatgac cctgcttgtg        60
     gtctcggtgc tggtctttgc catcatcaac ctgcccccgg gcgattacct gtccaaccag       120
     atcgccgagc tcaaggcctc gggccagtcg gcgggtgtgg ccaaggcaga gttcctgcgc       180
     aaggaatacg cgctcgaccg gcccgtctgg cagcaataca tgatctggat gggcttcatg       240
     cccggcccgc acgggttttc cggcctgatc cagggcaatt tcggctggtc ctttgaattc       300
     gatcggcccg tttccgagat cgtcggcgac agcctgtggc tgaccgtgct ggtgaacatg       360
     gcggccattg tctttgtcta tgccacggcc ttgccgctgg gggtgatcgc ggccgccaag       420
     gcgcggacct gggccgatta tacctcggcc tttgtcggct atctgggtct ggcgacgccg       480
     aacttcctgt tggcgctgat cctgtattat tacgggcgca aatatctgga tatccccatc       540
     ggcggtctca tggacccggc ctttgaaggg caacctatga gctgggccaa gatccagtcg       600
     gtgctggtgc acctgatcgt gcccaccatc gtcatcggca ccgccggtgc ctcggcgatg       660
     atgcagcgcc tgcgcgccaa catgctggac gagctgggca aaccctatgt ggagactgcc       720
     atcgccaagg gcatggcgcc cagccggatg ctggccaaat acccgctgcg cgtcgccttc       780
     aacccgtttg tggccgatat cggcaacctg ctgccctcga tggtgtcggg ctcggttctg       840
     gtctcggtgg tgatggggct gcaaaccatc ggcccgaccc tgctgaccgc actcaagagc       900
     caggacatgt tcctgtcggg cttcgtgctg atgttcgtgg cgctgctgac gctgatcggg       960
     acgatgattt ccgatatcct gctggtcatg ctcgacccgc gcattcgata cgaggggcgc      1020
     gacgcatga                                                              1029
//

If you have problems or comments...

PBIL Back to PBIL home page