(data stored in ACNUC7421 zone)

EMBL: CP000031.PE551

CP000031.PE551       Location/Qualifiers
FT   CDS_pept        complement(558370..560286)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0560"
FT                   /product="oligopeptide ABC transporter, periplasmic
FT                   oligopeptide-binding protein"
FT                   /note="identified by similarity to GB:BAB50197.1"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0560"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93876"
FT                   /db_xref="GOA:Q5LVY4"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LVY4"
FT                   /protein_id="AAV93876.1"
FT                   /translation="MLELPRRAFALALTMVLAGVLPLRADTVPTLQESVFWGAEVKSGD
FT                   LPPIDQRIPEEPLIVDLAAKGREFGTPGGVMRTMITRSKDIRQMVVYGYARLVGYDENY
FT                   NLVPDLLKSYEVEEDRRFTLHLRKGHKWSDGAPFTSADFEYWWKDVANNPLLSPAGPPD
FT                   FLLIEGQPPRVSFPDATTVMFEWDKPNPNFLQSLAQARPPFIYRPAHFLKQFHQDYADT
FT                   AQLAAAVEENRVKSWAALHNKLDNMYQFDNAQLPTLQPWINASEGKKIRHNFVRNPYYH
FT                   RIDTRGVQLPYIDIIEMEIVAPGLVAAKSNAGEVDLQGRGLDFRDASILKKGEADGGYK
FT                   TYLWQTGVASQIAIYPNLNHNDDVWRALLRDARLRRALSLAIDRDAINRALYFKLAKPG
FT                   AMAVLPASPFFKQEHRDAWAAYDPARASALLDEVGLDKRDGAGIRLLPDGRPMELVIET
FT                   AGERQEVENALQIITDTWREIGVKLVMRPLDRDILRNRVFAGTTMASVWFGWDNGLPQA
FT                   YTSPAYLAPTDQVFLAWPKWGQHYQTAGQVGEAPDLPEAQRLMELLHDWERANNDQDRA
FT                   AAWSEMLAIHADQIYGIGILAEAPQPIVVSARMRNVPKKGMWAWDPGAHFGVHRMDEFF
FT                   IQD"
     atgcttgaac tgccccgccg cgcctttgcg cttgccctga ccatggttct ggccggggtg        60
     ttgccgctgc gtgccgacac cgtgccgacc ttgcaggaat ccgtcttttg gggggccgag       120
     gtgaaatcgg gcgatctgcc acccatcgac cagcgcatcc ccgaggaacc gctgatcgtc       180
     gatctcgcgg ccaagggccg cgagtttggc acgccgggcg gggtgatgcg caccatgatc       240
     acccggtcca aggatatccg ccagatggtc gtctatggct atgcccgcct ggtcggatat       300
     gacgaaaact acaacctggt gcccgacctg ctgaaatcct atgaggtcga agaggaccgt       360
     cgctttaccc tgcacctgcg caaggggcac aaatggtctg acggcgcgcc ctttacctcg       420
     gccgatttcg aatactggtg gaaggatgtg gccaacaacc cgctgctcag ccccgccggt       480
     ccgcccgact ttctgctgat cgaaggccag ccgccccggg tcagctttcc cgacgccacc       540
     acggtcatgt ttgaatggga caagcccaac cccaatttct tgcaatccct ggcccaggcg       600
     cgcccgccct tcatctatcg accggcgcat ttcctgaaac agttccacca ggattacgcc       660
     gataccgcgc aactggccgc cgcggtcgag gaaaaccggg tcaagagctg ggccgcgctg       720
     cataacaagc tggacaacat gtaccagttc gacaatgccc agctgccgac cctgcaaccc       780
     tggatcaacg ccagcgaagg caagaagatc cgccacaact tcgtccgcaa tccctattac       840
     caccggatcg acacgcgcgg ggtgcagctg ccctatatcg acatcatcga gatggagatc       900
     gtcgcccccg gcctggtggc ggccaagtcg aacgcgggcg aggtcgatct tcaggggcgc       960
     gggctcgact ttcgcgatgc ctcgatcctg aagaaaggtg aggccgatgg cggatacaag      1020
     acctatctgt ggcagaccgg cgttgcctcg cagatcgcga tctatcccaa cctcaaccac      1080
     aatgatgatg tctggcgggc gctgctgcgc gatgcccgtc tgcgtcgggc cctgtcgctg      1140
     gcaatcgacc gcgacgcgat caaccgggcg ctttacttca agctggccaa gcccggcgcc      1200
     atggcggtgc tgccggcctc gcccttcttc aagcaggaac accgtgacgc ctgggccgcc      1260
     tatgaccccg cccgggccag tgcgctgctg gacgaggtcg ggctggacaa gcgcgacggc      1320
     gcgggcatcc gcctgctgcc cgatggccgc ccgatggagc tggtgatcga aacggcgggc      1380
     gagcggcagg aggtcgagaa cgcgctgcag atcataaccg acacctggcg cgagatcggg      1440
     gtcaagctgg tcatgcgccc gctggaccgc gacatcctgc gcaaccgggt ctttgccggc      1500
     accaccatgg catcggtctg gttcggctgg gacaatggcc tgccccaggc ctatacctcg      1560
     ccggcctatc tggcacccac cgatcaggtg ttcctggcct ggccgaaatg gggacagcat      1620
     tatcagaccg ccggtcaggt gggcgaggcg cccgacctgc ccgaagcgca gcggctgatg      1680
     gagctgctgc acgactggga gcgcgccaac aacgatcagg accgcgccgc cgcctggagc      1740
     gagatgctgg cgatccatgc cgaccagatc tatggcatcg gcattctggc cgaggcgcca      1800
     cagcccatcg tggtgtcggc ccggatgcgc aacgtgccga aaaaaggcat gtgggcctgg      1860
     gatccggggg cacatttcgg cgtgcaccgg atggacgaat ttttcattca agactga         1917
//

If you have problems or comments...

PBIL Back to PBIL home page