(data stored in ACNUC7421 zone)

EMBL: CP000031.PE553

CP000031.PE553       Location/Qualifiers
FT   CDS_pept        562275..562796
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0562"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to GB:BAB50200.1"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0562"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93877"
FT                   /db_xref="GOA:Q5LVY3"
FT                   /db_xref="InterPro:IPR025690"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="PDB:3IHT"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LVY3"
FT                   /protein_id="AAV93877.1"
FT                   /translation="MREMQIMSQPEQSRLDLFIDRMVSQRACLEHAIAQTAGLSGPVYE
FT                   LGLGNGRTYHHLRQHVQGREIYVFERAVASHPDSTPPEAQLILGDIRETLPATLERFGA
FT                   TASLVHADLGGHNREKNDRFARLISPLIEPHLAQGGLMVSSDRMYFEGLEELPLPPGAV
FT                   VGRCFIYRRG"
     atgagggaga tgcagatcat gagccaacca gagcagagcc gtcttgacct gttcatcgac        60
     cggatggtgt cgcagcgcgc ctgtctggag catgccatcg cgcagaccgc gggcctgagc       120
     gggccggtct atgaactggg cctgggcaac gggcgcacct atcatcacct gcgccagcat       180
     gtgcaggggc gcgaaatcta tgtgttcgaa cgcgcggtgg cctcgcatcc cgattcgacc       240
     ccgcccgagg cacagctgat cctgggtgat atccgcgaga ccctgccggc gacgctggag       300
     cggttcggcg ccaccgccag cctggtccat gccgatctgg gtggccataa ccgggaaaag       360
     aacgatcgtt tcgcccgcct gatttcgccc ctgatcgaac cgcatctggc gcagggcggg       420
     ctgatggtgt cgagtgaccg gatgtatttc gaggggctcg aggaactgcc gctgcccccc       480
     ggcgcggtcg tggggcgctg cttcatctac cggcgcggat ga                          522
//

If you have problems or comments...

PBIL Back to PBIL home page