(data stored in ACNUC7421 zone)

EMBL: CP000031.PE56

CP000031.PE56        Location/Qualifiers
FT   CDS_pept        complement(55919..56911)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0056"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0056"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93387"
FT                   /db_xref="GOA:Q5LWK1"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWK1"
FT                   /protein_id="AAV93387.2"
FT                   /translation="MAQRRKILTAGGTVLCAALIGFLMQQNAARETQQVAARKSFIQQS
FT                   VLKPSGASDVDDFAQFELHAIKLTSAQPALEQPRRLPEPALEGALPLPARDILLPDAPS
FT                   DPEEPQLGCAIIANAAPAPMASVALDVSAPCYGNQRVTVHHSGLIFTDTTDDAGTLSVT
FT                   VPALSETAVFVVAFQNGRGAVAMSPVEGLDRIDRVVVQWSGAAGFQLHAREFGAGYGET
FT                   GHVWSQSTDQGIGQVIRLGEPDTLEPQLAEIYSYPNGESDTAGTITLSIEAEVTATNCG
FT                   RDISAQSLELRGAGSLTTHDLDMSMPDCSAAGDFLVLNNLVEDLKIAAR"
     atggcacaac gacgcaagat actgacagct ggcggaaccg ttctctgcgc ggcgctgatc        60
     gggtttctga tgcagcagaa cgccgcgcgc gagacgcagc aggtggcggc acgcaaatcg       120
     ttcatccagc aatcggttct gaaaccctcg ggcgcatccg atgtggatga ctttgcccag       180
     ttcgaactgc acgcgatcaa gctgacctcg gcccagcccg ctctggaaca gccccgccgc       240
     ctgcccgaac cggcgctcga aggcgccctg cccctgcccg cgcgggacat ccttctgcct       300
     gacgcgccca gcgaccccga agagccgcaa ctgggttgtg cgattatcgc aaacgccgca       360
     cctgccccca tggccagcgt cgcccttgac gtcagcgcgc cctgctatgg caaccagcgt       420
     gtcaccgtgc atcacagcgg cctgatcttt accgatacga cagatgacgc gggcaccctg       480
     tcggtgaccg tcccggccct gtccgagacc gccgtttttg tcgtggcttt ccagaatggc       540
     cgtggtgccg tcgcgatgag ccctgtcgag gggctcgacc ggatcgaccg ggttgtcgtg       600
     caatggtcgg gcgcggcggg ctttcagctg cacgcgcgcg aattcggcgc cggctatggc       660
     gagaccggcc atgtctggtc ccagtccact gaccagggta tcggacaggt catccgtctg       720
     ggagagcccg acacgctgga accgcaactg gccgagatct acagctatcc gaacggcgag       780
     agcgataccg caggtaccat caccttgtcg atcgaggccg aggtgaccgc caccaattgc       840
     ggccgcgaca tctcggcaca gtcgctggaa ctgcgcggcg ccggatcgct gacaacccat       900
     gatctggaca tgtccatgcc cgattgttct gctgccggtg actttctggt gttgaataat       960
     ctggtcgaag acctgaagat cgccgccagg taa                                    993
//

If you have problems or comments...

PBIL Back to PBIL home page