(data stored in ACNUC7421 zone)

EMBL: CP000031.PE564

CP000031.PE564       Location/Qualifiers
FT   CDS_pept        complement(583201..583596)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0573"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to GB:AAQ87470.1"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0573"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93888"
FT                   /db_xref="GOA:Q5LVX2"
FT                   /db_xref="InterPro:IPR021737"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LVX2"
FT                   /protein_id="AAV93888.1"
FT                   /translation="MFLPVTIGSLLLVLGLFQIKHMFADFFLQTPRMLSGRCQYWHLGR
FT                   AQHAGVHAVGSVLLFLVVGAPVVFALVIAVVEWVVHFNIDYGKASYSDRKALQPNQAKY
FT                   WHAMGFDQFLHQLTYLAMAWAWVEFAH"
     gtgttcttgc ctgtaacgat aggctctttg ctgctggtgc ttggcctctt ccagatcaag        60
     cacatgtttg cggatttctt tctgcagaca ccccggatgc tgtccgggcg ttgccagtat       120
     tggcatctgg gccgcgccca gcatgccggt gtgcatgcgg tgggctcggt tctgctgttt       180
     ctggtggtcg gggcgccggt cgtttttgcc ctggtgatcg cagttgtgga atgggtggtg       240
     catttcaaca tcgattacgg caaggccagc tattcggacc gcaaggcgct gcaacccaat       300
     caggcgaaat actggcatgc gatggggttc gaccagttcc tgcatcaact gacctatctg       360
     gcgatggcct gggcctgggt cgaattcgcg cactag                                 396
//

If you have problems or comments...

PBIL Back to PBIL home page