(data stored in ACNUC7421 zone)

EMBL: CP000031.PE565

CP000031.PE565       Location/Qualifiers
FT   CDS_pept        583706..586804
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0574"
FT                   /product="ABC transporter, transmembrane ATP-binding
FT                   protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0574"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93889"
FT                   /db_xref="GOA:Q5LVX1"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LVX1"
FT                   /protein_id="AAV93889.1"
FT                   /translation="MSGRDSLGEGRRLRVWRPSCLRPILGVGAIERTLFRFIWKYSRRD
FT                   QLILLMVTATLFPLLYLTLELPKRIINDAIGAASSTIEVWGFTFDQVTYLGILCAAFLI
FT                   SVLAHGLMKMRINTMKGVMSERMLRRFRYLLITRVLRFPQPYFERVSQGELVSMITAES
FT                   EPMGGLMGDAISQPVLQAGQMITILSFLFLQSLWFGLAAVALIPLQAWLIPRMQRQINL
FT                   LNKKRIQEVRVLAAQIGENAAGAATLRSNAGWPWRMSMISYQLGRLFTIRFDIYQKKFF
FT                   MKFVNNFIGQLTPFLFYSIGGYLVLQGSVSLGALVAALAAYKDLSSPWKELLTYYNQTQ
FT                   DMSLRWEVILDRFAPPGMIDEDKFTGFPDERPRLIGDIVLDKVSVRDADGNLVLDDLDL
FT                   TLPGGKVIGIAASSEEDRRALSELLTREVLPASGQVRIGEIALSDLHQMVVASRIGHAT
FT                   SRPVLFQGTFGDNVTMPVRVRPQGDSGEPGFHAETLRAGNSADPYHSDWLEPGLAGFDD
FT                   ARALRDWWLKLVEGLGSGAALYRRGAEQVFAEADHPDLAARLVALRPVIQEAAERAGLA
FT                   GQAHFFDPDHYNPALPVAENLLFASPRAPFTPEVLAGQTDFLEQIRQIGLDEPLVRLTQ
FT                   DVIDMLRQIFGLDGTDHPLFRKMNLDVRTYETALELVEKTRDAGARALEDDQLASLLAV
FT                   PFRISADQIGPAFSDQIKARILELRKSHSSELMRSLDDVFAPLDPGAFAPGLNVLENAL
FT                   FGKVSEVGGARSDELRKLITDLLDEHGLRPQVIQLIYDLPVTLGGQNVPAIFAEPLAFT
FT                   RATIKRPDILLLDRALASYDMQTQIAVYRNLRALLPETTLIYLNDAFENPDVFDLYVEV
FT                   QQGRIVTEEVPRQQEEEDSVASADLSRKVRTLEQTPLFSGLDRRQLRLLAFGARWYSAK
FT                   AGEVVFLKDDEPTDGAYMMIEGEAGLYLPREGQEDQLIVTVGPGRLVGELGLIRKEPRA
FT                   LSMVAATDITCLRIGEEEFLAVVENDAATAFKLLQVVAGYVSN"
     atgtcgggcc gcgatagcct tggtgagggt cgcaggcttc gggtatggcg gccgagttgt        60
     ttaaggccga ttttgggggt cggagctata gaacgcacat tgttccgctt catctggaaa       120
     tattccagac gcgatcaact gatcctgttg atggtgacgg cgaccctgtt tccgctgctc       180
     tatctgacgc ttgagctgcc caaacgcatc atcaacgacg ccatcggtgc ggccagttcc       240
     accatcgagg tctggggctt tacctttgac caggtgacct atctgggcat cctttgcgcg       300
     gctttcctga tctcggttct cgcccacggg ctgatgaaga tgcggatcaa caccatgaaa       360
     ggcgtgatgt ccgaacggat gctgcgccgg ttccgctatc tgttgatcac ccgtgtcctg       420
     cggtttccgc aaccttattt cgagcgcgtc agccagggcg agctggtgtc gatgatcacc       480
     gccgaaagcg agccgatggg cgggctgatg ggcgatgcga tcagccagcc ggtgctgcag       540
     gccgggcaga tgatcaccat cctgtccttc ctgttcctgc aaagcctctg gttcgggctg       600
     gcggccgtgg cgctgatccc gctgcaggcc tggctgatcc cgcgcatgca gcggcagatc       660
     aacctgctca acaagaaacg cattcaggag gtgcgcgttc ttgccgccca gatcggcgag       720
     aatgctgcgg gcgccgcgac gctgcgatcc aatgccggct ggccctggcg gatgtcgatg       780
     atcagctatc agctggggcg gctgttcacg atccgcttcg atatctacca gaagaagttc       840
     ttcatgaagt tcgtgaacaa cttcatcgga cagttgacgc ccttcctgtt ctattcgatc       900
     ggcggctatc tggtgttgca gggcagcgtg tcgctgggtg cgctggtggc cgcattggcg       960
     gcctacaagg atctgtccag cccctggaag gaactgctga cctattacaa ccagacccag      1020
     gacatgtcgc tgcgctggga ggttatcctg gaccggttcg cccccccagg catgatcgac      1080
     gaggacaagt tcaccggctt ccctgacgag cgcccgcgcc tgattggcga tatcgtgctc      1140
     gacaaggtct cggttcgcga tgccgatggc aatctggtgc tggacgatct cgatctgacc      1200
     ctgcccggcg gcaaggtgat cggcatcgcc gccagcagcg aagaggatcg tcgcgccctg      1260
     tccgagttgc tgacccgcga ggtgctgccc gccagcggac aggtgcggat cggcgagatc      1320
     gcgctgtcgg acctgcacca gatggtggtg gcctcgcgga tcgggcacgc cacctcgcgc      1380
     ccggtgctgt tccaaggcac gttcggcgac aacgtgacga tgcctgtgcg ggtgcgccca      1440
     cagggtgaca gcggtgagcc gggctttcac gccgagaccc tgcgcgccgg caacagcgcc      1500
     gacccctatc acagcgattg gctggagccg ggtctggccg ggttcgacga tgcccgcgca      1560
     ctgcgcgact ggtggctgaa actggttgag gggctgggct cgggggcggc gctctaccgg      1620
     cgcggcgccg aacaggtgtt tgccgaggcc gatcacccgg atctggcggc gcggctggtg      1680
     gcgctgcgcc cggtgatcca ggaggcggca gagcgcgcgg gtcttgccgg gcaggcgcat      1740
     ttctttgatc cggaccacta caacccggcg ctgccggtgg ccgaaaacct gcttttcgcc      1800
     agcccgcgcg cgcccttcac gcccgaggtt ctggccggac agaccgattt tctcgagcag      1860
     atccgccaga tcggactgga cgagccgctg gtgcgcctga cccaggacgt gatcgacatg      1920
     ctgcgccaaa tcttcggact ggatggtacc gaccacccgt tgttccgcaa gatgaacctg      1980
     gatgtgcgca cctatgaaac cgcgctggaa ctggtggaaa agacccggga tgccggcgcc      2040
     cgggcgcttg aggatgatca gctcgccagc ctgctggccg tgcccttccg gatctcggcg      2100
     gatcagatcg gcccggcctt ttcggatcag atcaaggccc gcattctgga actgcgcaag      2160
     agccactcga gcgagctgat gcgcagcctg gacgatgttt ttgcgccact cgacccgggg      2220
     gcctttgcgc ccgggctgaa cgtgctggag aacgcgctgt tcggcaaggt aagcgaggta      2280
     gggggcgcgc gctcggacga gctgcgcaag ctgatcaccg atctgctgga cgaacacggt      2340
     ctgcggccgc aggtgatcca gctgatctac gatctgccgg tcaccctggg tggacagaac      2400
     gtgccggcga tctttgccga gccgctggcc tttacccgcg cgacgatcaa gcggcccgat      2460
     atcctgctgc tcgaccgggc gctggccagt tacgacatgc agacccagat cgcggtctat      2520
     cggaacctgc gggcgctgtt gcccgagacc acgctgatct atctcaacga cgcgttcgag      2580
     aatccggatg tcttcgatct ttatgtcgag gtccagcagg gccggatcgt gaccgaggaa      2640
     gtgccccgac agcaggagga agaggacagc gtcgcctcgg ccgacctgag ccggaaggtg      2700
     cgcacgctgg aacagacgcc gctgttttcc ggtctcgacc ggcggcagct gcgcctgctg      2760
     gcctttggcg cgcgctggta ttccgccaag gcaggtgagg tggtgttcct gaaggatgat      2820
     gagccgaccg atggcgccta tatgatgatc gagggcgagg cggggctcta cctgccgcgc      2880
     gaggggcagg aggatcagct gatcgtgaca gtcgggccag gtcgcctggt gggcgaattg      2940
     ggcctgatcc gcaaggagcc acgcgcgctg agcatggtgg cggcgacgga tatcacctgt      3000
     ctgcgcatcg gtgaggaaga gttcctggca gtggtcgaga acgatgcagc gaccgcattc      3060
     aaattgcttc aggtggtggc gggttacgtg tcgaactga                             3099
//

If you have problems or comments...

PBIL Back to PBIL home page