(data stored in ACNUC7421 zone)

EMBL: CP000031.PE568

CP000031.PE568       Location/Qualifiers
FT   CDS_pept        588797..590560
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0577"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to PIR:D83286"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0577"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93892"
FT                   /db_xref="GOA:Q5LVW8"
FT                   /db_xref="InterPro:IPR010839"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LVW8"
FT                   /protein_id="AAV93892.1"
FT                   /translation="MTAALRIGGACGFWGEAPHATAQLLAAGVDVLVYDYLAEITMSIM
FT                   ARARLKDPDQGYATDFVTEAMVPNLTAIAKQGVRVLSNAGGVNPEACAEALRERIAAAG
FT                   LSLRVAVVTGDDLLARASEFVKCTEMFTGAAMPPLERIASMNAYLGAAPVVAALRAGAD
FT                   IVLTGRCADSALTLAACVHHFGWDLSDHDRLAAGSLAGHLLECGPQATGGNFTDWEVAG
FT                   DLARIGYPIAEVAADGGFVLTKPEGSSGLVTPATVGEQMLYEIGDPRAYLLPDVVCDFS
FT                   GVTLEQAGPDRVRVSGARGRAPTGRLKVSVTWADGYRGGMVFQMTGRAARAKAQAFAQA
FT                   GLDRAQARLAALGAPGYREVSFEAFGGRPAPDAPEEIAFKAAVRHDDARAVGLFLKELV
FT                   GAALATPPGLHFFTGAGRPRPSPVVALFSCLIPADAVRASVVLDGADLSFDAPAPPLRD
FT                   IEEGLAPCPPEPDMELELEMRPLEALAWARSGDKGDSANIGVLARRPDYMPYIWAALSP
FT                   EAVMRFFDEKSPAQIQRFYLPGCHAMNILLTGALGGGGVASLRNDAQGKAFAQELLSLP
FT                   VPVPVGLITTD"
     gtgacagcag cgttgaggat cggcggggcc tgcggcttct ggggcgaggc gccgcatgcg        60
     acggcacagc ttcttgcggc cggggtcgat gtgctggtct atgactacct ggccgagatt       120
     accatgtcga tcatggcgcg cgcgcggctg aaggatccgg atcagggcta tgccaccgat       180
     ttcgtgaccg aggcgatggt gccgaacctg acggccattg ccaagcaggg ggtgcgggtg       240
     ctgtcgaatg ccggcggtgt gaaccccgag gcctgcgcag aggcgctgag agagcggatc       300
     gcggcggcag gcttgtcgct gcgggtggcg gtggtcactg gcgatgacct gctggcgcgc       360
     gcctcggagt ttgtcaagtg taccgagatg ttcaccggcg ccgccatgcc accgctggag       420
     cggatcgcgt cgatgaatgc ctatctgggc gcggcgccgg tggtggcggc gctgcgggca       480
     ggggcggata tcgtgctgac cgggcgctgt gccgacagcg ccctgacact ggcggcctgt       540
     gtgcaccact ttggctggga cctgtccgat catgaccgac tggcggcggg gtcgctggcc       600
     gggcacctgc tggaatgtgg cccacaggcg accgggggca atttcaccga ttgggaggtg       660
     gcgggcgatc tggcgcggat cggctatccc atcgcagagg tcgccgccga tggcggtttt       720
     gtcctgacca agcccgaggg cagcagcggg ctggtgaccc cggccacggt gggcgaacag       780
     atgctgtacg agatcggcga tccacgcgcc tatctgctgc ccgatgtggt ctgcgatttc       840
     tcgggcgtga cgctggagca ggcggggccg gaccgggtgc gcgtcagcgg tgcgcgcggg       900
     cgggcgccga ccggacggct caaggtctcg gtcacctggg ccgatggcta tcgcggcggc       960
     atggtgttcc agatgaccgg gcgcgcggcc cgggccaaag cgcaggcctt tgcccaggcc      1020
     gggcttgacc gggcgcaggc acggctggcg gcgctgggcg cgcccggcta tcgcgaggtc      1080
     tcgttcgagg catttggcgg gcgcccggcc ccggatgcgc ccgaagagat cgcgttcaag      1140
     gccgcggtgc gccatgacga tgcgcgcgcg gtggggctgt tcctcaagga actggtgggc      1200
     gcggccttgg cgactccgcc ggggttgcac tttttcactg gcgcggggcg gccacgcccc      1260
     tcgccggtgg tggcgctgtt ttcctgcctg atcccggctg atgcggtgcg cgccagtgtg      1320
     gttctggacg gggccgacct gtcctttgac gcacccgcgc cgcccttgcg tgacatcgaa      1380
     gagggtctcg cgccctgtcc acccgagccg gatatggaac tggagctgga gatgcgcccg      1440
     ctggaagcgc tggcctgggc gcgctctggc gacaagggcg acagcgccaa tatcggcgtg      1500
     ctggcccggc gcccggatta catgccctat atctgggcgg ccctgtcgcc cgaggcggtg      1560
     atgagatttt tcgacgaaaa atctcccgcc caaatccaac gtttctatct gccgggctgt      1620
     catgcgatga atatcctgct gacaggggcg ttgggcggcg gcggggtggc cagcctcaga      1680
     aacgacgcgc agggcaaggc ctttgcccaa gagcttctgt ccctgccggt gcccgttccg      1740
     gtcgggttga tcacaacgga ttag                                             1764
//

If you have problems or comments...

PBIL Back to PBIL home page