(data stored in ACNUC9435 zone)

EMBL: CP000031.PE572

CP000031.PE572       Location/Qualifiers
FT   CDS_pept        595304..596095
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0581"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to GB:CAB95889.1"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0581"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93896"
FT                   /db_xref="GOA:Q5LVW4"
FT                   /db_xref="InterPro:IPR017517"
FT                   /db_xref="InterPro:IPR017518"
FT                   /db_xref="InterPro:IPR024344"
FT                   /db_xref="InterPro:IPR034660"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LVW4"
FT                   /protein_id="AAV93896.1"
FT                   /translation="MEQAGDFLAECQALDAVLDGVSGADWDRPTQFKGWTLNDVLVHLH
FT                   FWNRMADLSLTDPAAFQARAAETLAGIGRDGFRATENAMITERGADLRAAWAAQYTDMA
FT                   ERWAGLDPKQRLQWVGPEMSARSSITARQMETWAHGQEVFDCLGATRTETDRIRNIVVL
FT                   GVNTFGWSFKVHGRPQPEMMPRLELTAPSGALWQFGEPGANRIAGPAVEFAQVVAQTRN
FT                   IADTSLVVEGPLAAEWMAIAQCFAGGPETPPAKGARHRVAG"
     atggaacagg caggcgattt tctggccgaa tgccaggcgc tggacgcggt actggacggg        60
     gtgagcggcg ccgattggga ccgccccacc cagttcaagg gctggaccct gaacgacgtg       120
     ctggtgcacc tgcatttctg gaaccggatg gcggatctgt cgctgacaga cccggctgcc       180
     tttcaggccc gcgccgccga gacccttgcg ggcatcgggc gcgacggctt tcgcgctacc       240
     gaaaacgcga tgatcaccga gcggggcgcc gatctgcgcg ccgcttgggc cgcgcaatac       300
     acggatatgg cggaacgctg ggcggggctt gaccccaagc agcggctgca atgggtcggt       360
     cccgagatgt cggcgcgctc gtccatcacc gcgcggcaga tggagacctg ggcccatggg       420
     caggaagtgt tcgactgtct tggcgccacc cggaccgaga ccgacaggat caggaacatc       480
     gtggtgctgg gggtgaatac cttcggctgg tcgttcaagg tacatggccg cccgcaaccc       540
     gagatgatgc cccggctgga gctgaccgcc ccctcgggcg cgctgtggca attcggcgaa       600
     ccgggcgcga accggatcgc cggcccggcg gtcgaattcg ctcaggtggt ggctcagacc       660
     cgcaacatcg ccgacacctc gctggtggtc gaaggcccgc ttgccgccga gtggatggcc       720
     atcgcgcaat gtttcgcggg cgggccggaa accccgcccg ccaagggcgc gcgccaccgc       780
     gtcgcgggtt ag                                                           792
//

If you have problems or comments...

PBIL Back to PBIL home page