(data stored in ACNUC9435 zone)

EMBL: CP000031.PE58

CP000031.PE58        Location/Qualifiers
FT   CDS_pept        59912..60742
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0058"
FT                   /product="PPIC-type PPIASE domain protein"
FT                   /note="identified by match to protein family HMM PF00639"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0058"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93389"
FT                   /db_xref="GOA:Q5LWL7"
FT                   /db_xref="InterPro:IPR000297"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWL7"
FT                   /protein_id="AAV93389.1"
FT                   /translation="MPSLAFALVMALPVAAETKAEADTVVARVNGEEITLGHMIIARAS
FT                   LPQQYQQLPDDVLFDGILDQLVQQTLLKQQQKGETPKQIVLSLENEERSLLAGETIEEI
FT                   MAVATTETAIQAAYDAQYADGFGGEEYNASHILVPSEDEAKAVKELLDNGADFAATAKE
FT                   KSTGPSGPNGGALGWFGAGAMVPEFEQAVVALNAGQVSDPVQTQFGWHVIILNDKRKSE
FT                   APALDEVRDELAGRIQQDAIEARLAELTKDSEIEKPELTGVEPAVLRQLELVRE"
     ttgccatcgc tggcgtttgc gctggtcatg gccctgccgg tcgcggccga gacaaaggcc        60
     gaggcggaca cggttgtggc ccgcgtcaat ggcgaagaga tcacgctggg tcacatgatc       120
     atcgcgcgcg cctcgctgcc gcagcagtat cagcaattgc ccgacgatgt gctgttcgac       180
     ggtatcctgg accagctggt ccagcagacc ctgctgaaac agcagcagaa gggcgagacc       240
     ccgaaacaga tcgtgttgtc gctggagaac gaggaacgct ccttgctggc gggtgagacc       300
     atcgaagaga tcatggccgt cgcaaccacc gaaacggcga tccaggcggc ttatgacgcg       360
     caatatgccg atgggttcgg cggcgaggaa tacaatgcct cgcatatcct ggtcccctcc       420
     gaggacgagg ccaaggccgt caaggaactg ctcgacaatg gcgccgattt cgccgccacc       480
     gccaaggaga aatccacagg tccgtccggg cccaatggcg gtgcgctggg ctggttcggt       540
     gccggcgcga tggtgccgga attcgaacag gcggttgtgg cgctgaacgc gggtcaggtt       600
     tcggacccgg tgcagaccca gttcggctgg catgtgatca tcctcaatga caagcgcaag       660
     tccgaggcgc cggcgctgga cgaggtgcgt gacgaacttg cgggccgtat ccagcaggac       720
     gccatcgagg cgcggctggc cgagctgacc aaggacagcg agattgaaaa gcccgagctg       780
     accggggtcg aacccgccgt gctgcggcaa ttggaactgg tgcgggagta a                831
//

If you have problems or comments...

PBIL Back to PBIL home page