(data stored in ACNUC7421 zone)

EMBL: CP000031.PE580

CP000031.PE580       Location/Qualifiers
FT   CDS_pept        605196..608468
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0589"
FT                   /product="oxidoreductase, NAD-binding/iron-sulfur
FT                   cluster-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0589"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93904"
FT                   /db_xref="GOA:Q5LVV6"
FT                   /db_xref="InterPro:IPR000951"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012832"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR028894"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LVV6"
FT                   /protein_id="AAV93904.1"
FT                   /translation="MVLLSIPRYAKRAVRRRRMGIRFFSDRDRPVHMGPYPLERLARRE
FT                   AVADLSTVPQIPVLSFHRPERPESIVNAMGEFQAMLDAIRDGLVNPARAEISADPLERA
FT                   NHLKAFGYFNDASMMGCGPLPAEALLPAPRRNPDIDRLAEALRTRQTKTLASGIDVIMA
FT                   DLKESMEAPPRPIDSHRHAIVFLYEHHRDPEADEPGAEWIHDAQDHRACLLASENAVVI
FT                   ANYIRLLGYDARAHTAMSSDVDLGRLALAAGLVTLEGGQLAAPWLGRRFGLAAVTTEME
FT                   LAHDRPLAPLAAQSWAATRGPAWWLGKGFAKSALNRDPYARRRYVDGAHPFERLNRVET
FT                   PTTYIDEANVARVPKRADMFARAQFGDMGKALQEGAKGGHYVRKAAPSFAQRRALGAFV
FT                   LLQDGDRADVPRPIDPRRNAANLKAASYFLGIDAVGLSRCPTWAWYSHDATGEAITPPH
FT                   DQAISMIVDQGYETMEGSSGDDWIAVAQSMRAYLRFSLLGGVIAQQIRNLGYKAKAHTV
FT                   MDGEVLQPPLLLLSGLGEVSRIGEVILNPFLGPRLKSGAVTTDMPMSHDKPIDFGLQRF
FT                   CEACNKCARECPSGAITAGPKRMFNGYEIWKSDSQKCATYRITTQGGAMCGRCMKTCPW
FT                   NLEGLFAERPFRWAAMTVPAAAPALARLDDALGHGGLNEVKKWWWDIELQPDGAYRPTT
FT                   GPVNRRGLQRDLDLKYEDQTLAVYPAPLAPHPWPYPFPMDREAGIAAYQAMIGADEYRA
FT                   RLAAGDLSVVHRYTVPDADTAPVIRVEVTRAEKMTGEITKYEFAAPDGAPLPEWTAGAH
FT                   LDVLVAPEFLRQYSMSGDPTDRTTYQIGVLREEEGRGGSKLMHRIFAPGRRVFISKPIN
FT                   HFELDEGATRSFLMGGGIGITPMIAFAHRLHALGADFELHYSVPSRTSAGYLEDLDAMP
FT                   WADRVHLHVSDEGSRADLDAVLAGFQPGWHVYTCGPERFMDGVMQAAERQGFPEEARHL
FT                   EYFSVPEQPAYENHPFTLKLARTGREIAVPADKDAAQVLNENGIHIDVKCSDGICGVCK
FT                   CGLIAGAVEHRDFVLSGKQREGAIILCQSRAAEPGGVVEIDL"
     atggttttgc tgtccattcc gcgctacgcc aaaagggcag tcaggaggcg caggatgggt        60
     attcgctttt tctcggaccg ggaccggccc gtgcatatgg gtccctatcc tttggagcgg       120
     ctggcccggc gcgaggcggt ggcggatctg tccactgttc cgcaaatacc tgtgctcagc       180
     tttcaccggc ccgagcggcc cgagagcatc gtcaacgcga tgggcgagtt tcaggcgatg       240
     ctggatgcga tccgcgacgg gctggtcaac ccggcccgcg ccgagatctc cgccgatccg       300
     ctggaacgcg ccaaccatct gaaagcgttt ggctatttca acgatgcttc gatgatgggc       360
     tgcgggccct tgccggccga ggcgctgttg ccggcgcccc ggcgcaaccc cgatatcgac       420
     cgattggccg aggcgctgcg gacccggcag accaagacgc ttgcctcggg catcgacgtg       480
     atcatggccg atctcaagga aagcatggag gcgccgccgc gcccgatcga cagccaccgc       540
     catgcgatcg tctttctcta cgagcatcac cgcgaccccg aggcggacga gccgggggcc       600
     gagtggatcc atgatgcgca ggaccatcgc gcctgtcttc tggccagcga aaacgcggtt       660
     gtgatcgcca attacatccg ccttctgggc tatgacgcgc gggcgcatac cgccatgtcg       720
     agcgatgtcg atctggggcg gctggcactg gcggcggggc tggtcacgct tgagggcggt       780
     cagctggccg caccctggct ggggcgccgc tttggtctgg ctgccgtcac caccgagatg       840
     gagctggccc atgatcgccc gctggcgccg ctggccgcgc agtcctgggc cgccacccgg       900
     ggcccggcct ggtggctggg caagggtttc gccaaaagcg cgctgaaccg cgacccctat       960
     gcccggcggc gctatgtgga cggggcacac ccgttcgagc ggctgaaccg ggtcgagacg      1020
     ccgaccacct atatcgacga agccaatgtg gcccgtgtgc ccaagcgcgc cgacatgttc      1080
     gcccgcgccc agttcggcga tatgggcaag gccctgcaag agggcgccaa gggcggtcac      1140
     tacgtgcgca aggcggcgcc cagctttgcc cagcggcggg cgctgggggc gtttgtgctg      1200
     cttcaggatg gcgaccgcgc cgatgttccc cggccaatcg atccgcgccg caatgccgcc      1260
     aacctcaagg cggcgagcta tttcctgggc atcgacgccg tcgggctcag ccgctgcccg      1320
     acctgggcgt ggtacagcca tgacgccacc ggcgaagcga tcaccccgcc gcatgatcag      1380
     gcgatcagca tgatcgtcga tcaggggtac gagacgatgg aagggtcgag cggtgacgac      1440
     tggatcgcgg tggcgcaatc catgcgcgct tacctgcgct tctcgctgtt ggggggggtg      1500
     atcgcgcagc agatccgcaa cctgggttac aaggccaagg cccatacggt gatggatggc      1560
     gaggtattgc aaccgcccct gctgctgctc tcgggcctgg gcgaggtcag ccgcatcggc      1620
     gaggtgatcc tgaacccgtt cctggggccg cgcctgaaat cgggggcggt gaccaccgac      1680
     atgccgatga gccatgacaa gcccatcgat ttcggcctgc aacggttctg cgaggcctgc      1740
     aacaaatgtg cacgcgaatg cccctcgggg gcgatcaccg ccgggcccaa gcggatgttc      1800
     aacggctacg agatctggaa atccgacagc cagaaatgcg ccacctatcg catcaccacc      1860
     cagggcggcg ccatgtgcgg gcgctgcatg aagacctgcc cgtggaacct ggaagggttg      1920
     ttcgccgaac gccccttccg ctgggcggcg atgacggttc cggcggcggc cccggctctg      1980
     gcgcggttgg acgatgcgct gggccacggc gggctgaacg aggtcaagaa atggtggtgg      2040
     gatatcgagt tgcagcccga tggggcctat cgcccgacca ccgggccggt gaaccggcgc      2100
     ggcctgcaac gggatctgga cctgaaatac gaggatcaga cgctggccgt ctatcccgcg      2160
     ccgctggcgc cgcacccctg gccctatccg tttccgatgg accgcgaggc ggggatcgcc      2220
     gcctatcagg cgatgatcgg cgccgacgaa taccgggcgc ggctggcggc gggggatctc      2280
     tctgtcgtgc accgctacac cgtccccgac gcggacaccg cgccagtgat ccgggtcgag      2340
     gtgacgcggg ccgagaagat gacgggcgag atcaccaaat acgagtttgc cgcccctgac      2400
     ggtgcgccgc tgcccgaatg gacggcgggc gcgcatctgg atgtgctggt ggcacccgaa      2460
     ttcctgcggc aatactcgat gtccggggac ccgacggacc ggacgaccta ccagatcgga      2520
     gtattgcgcg aggaggaggg gcgcggcggc tcaaagctga tgcatcgcat ctttgcgccg      2580
     ggccggcggg tgttcatctc gaagccgatc aatcatttcg aactggatga aggggcaacc      2640
     cgcagctttc tgatgggcgg cggtatcggc atcacgccga tgatcgcctt tgcgcaccgg      2700
     ctgcacgcgc tgggggctga tttcgagctg cattattcgg tccccagccg caccagcgcg      2760
     ggatatctgg aggacctcga cgccatgccc tgggcggacc gggtgcatct gcatgtctcg      2820
     gacgagggat cgcgcgccga tctggatgcg gttctggcgg gcttccaacc cggctggcat      2880
     gtctatacct gcggtcccga gcgtttcatg gacggggtga tgcaggcggc cgaacggcag      2940
     ggtttcccgg aagaggcccg gcatctggag tatttctcgg tccccgaaca gcccgcgtat      3000
     gaaaaccacc cctttacgct gaaactcgcc cggacagggc gcgaaatcgc ggtgcccgcg      3060
     gacaaggatg ccgcgcaggt gctgaacgag aacgggatcc atatcgacgt caaatgctcg      3120
     gacgggatct gcggcgtctg caaatgcggg ctgatcgcgg gcgcggtcga acatcgcgat      3180
     ttcgtgctgt ccgggaagca gcgcgagggc gcgatcatcc tgtgccagtc ccgcgcggca      3240
     gagccgggcg gggtggtcga aatcgacctc tga                                   3273
//

If you have problems or comments...

PBIL Back to PBIL home page