(data stored in ACNUC9435 zone)

EMBL: CP000031.PE594

CP000031.PE594       Location/Qualifiers
FT   CDS_pept        complement(623032..623346)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0603"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to PIR:AH0077"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0603"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93918"
FT                   /db_xref="GOA:Q5LVU2"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR014910"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LVU2"
FT                   /protein_id="AAV93918.1"
FT                   /translation="MSTQKIWDLHLTYDGPLSQEFLTGTRQLAESIAQEPGIVWKIWTV
FT                   EDGTNHFGSTYLFRTLDHLETYKKMHLKRLADFGIRVVSDHVFDIMEELSAIDNAPLQG
FT                   "
     atgagcacac agaaaatctg ggacctgcac ctgacctacg atggcccgct cagccaggag        60
     ttcctgaccg gaacccgaca gctggcggaa agcatcgccc aagagccggg catcgtctgg       120
     aagatctgga ccgtcgagga cggaaccaac cacttcggct cgacctatct tttccgcact       180
     ctcgaccatc tcgaaactta caagaagatg catctgaaac ggcttgccga tttcgggatc       240
     agggtggtct cggaccatgt ctttgacatc atggaggagt tgagcgcaat cgacaacgcg       300
     ccgcttcagg gttag                                                        315
//

If you have problems or comments...

PBIL Back to PBIL home page