(data stored in ACNUC7421 zone)

EMBL: CP000031.PE597

CP000031.PE597       Location/Qualifiers
FT   CDS_pept        624480..626168
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0606"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to PIR:C95874"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0606"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93921"
FT                   /db_xref="GOA:Q5LVT9"
FT                   /db_xref="InterPro:IPR002840"
FT                   /db_xref="InterPro:IPR007506"
FT                   /db_xref="InterPro:IPR012047"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LVT9"
FT                   /protein_id="AAV93921.1"
FT                   /translation="MAQCIVAAAASGPVLVCDEGLSFWGGVDPETGRVIDAHHPQHGAA
FT                   LAGAVVMMPTSRGSCSGSGVLLALALNGHAPAALVFREGEDVLTLGALVAAWMYDRPVA
FT                   VLRLSAAEYAALAMEPSAEVTPERLTAGALSLTLEPLSGETLDLSDADRAMLSEEAAPP
FT                   VRLAMRIICAMAAAQGAERLTDVSRAHIDGCIYHSEANLRFAEDMAAMGGRVCIPTTMN
FT                   AISVDHANWRAQGVPPAFGGPASRLADAYLRMGARPSFTCAPYLLDDIPQAGEAIAWAE
FT                   SNAVVYANSVLAARSVKHPDYLDLCMALTGRAPLAGVYLDANRKAQVEIRVERPEGADD
FT                   AFWPLLGYLAGRLAPDRIPLLTGLEGSAPSGDDLKALCAAFGTTSAAAMLHVAGVTPEA
FT                   DGALTDGAAHMAIAPGDFARAWDQFNPGPQRVELVAIGSPHASAHECRVLTDLLDGHRI
FT                   ADGTATIVTIGRGERDKLAGDGVLARLQALGVQVIPDLCWCSVTEPVLPPATRTIMTNS
FT                   GKYAHYGPGLSGRAMRFGSLAHCAEAALTGYAPGRPGWINGQDRV"
     atggcacaat gcatcgttgc ggccgcggcg tcgggaccgg ttctggtctg tgacgagggt        60
     ctcagtttct ggggtggggt cgatcccgag acggggcgag tgatcgacgc gcaccacccc       120
     cagcacggtg cggcgctggc aggggcggtg gtgatgatgc cgaccagccg cggctcatgc       180
     tcgggcagcg gcgtgctgct ggctttggcg ctgaatggcc atgctccggc ggcgttggtg       240
     tttcgcgagg gcgaggatgt tctgacgctt ggcgcgctgg tcgcggcgtg gatgtatgac       300
     cggccggttg cggtgctgcg cctgtcggcg gcggaatacg ctgcgctggc gatggagcct       360
     tcggccgagg taacgcccga gcgcctgacg gcgggggcgc tgtcgctgac gctggaaccg       420
     ctttcaggtg agacgctgga cctcagcgat gccgaccgcg ccatgctgtc cgaggaggcc       480
     gcaccgccgg tgcggctggc gatgcggatc atctgcgcca tggcggccgc acaaggtgcc       540
     gagcggttga ccgatgtcag ccgcgcccat atcgacggtt gcatctatca cagcgaggcc       600
     aatctgcgct ttgccgagga tatggccgcg atgggcgggc gggtctgtat ccccaccacc       660
     atgaatgcga tctcggtcga tcatgcaaac tggcgcgcgc agggcgtgcc gcccgcgttc       720
     ggcgggccgg ccagccggct ggccgatgcc tatctgcgga tgggggcgcg gcccagtttc       780
     acctgtgcgc cctatctgct cgacgacatc ccgcaggcgg gcgaggccat cgcctgggcc       840
     gagtcgaacg cggttgtcta tgccaacagc gttctggccg cgcgcagcgt gaaacatccc       900
     gattacctcg acctgtgcat ggcgctgacg ggccgggcgc ccttggctgg cgtctatctg       960
     gacgccaacc gcaaggcgca ggtggaaatc cgggtggagc ggcccgaggg cgcagacgac      1020
     gcgttctggc ccttgctcgg ctatctggcc gggcggctgg cgcccgaccg tatccctctc      1080
     ctcaccgggc tggagggcag cgcgccgtcc ggggatgatc tcaaggcgct ctgtgctgcc      1140
     ttcggcacca cctcggcggc ggcgatgctg catgtggcgg gtgtcacgcc cgaggctgac      1200
     ggggccttga ccgatggcgc ggcgcatatg gccattgcac cgggtgactt cgcccgcgcc      1260
     tgggatcaat tcaatcccgg gccccagcgg gtggaactgg tcgccattgg cagcccgcat      1320
     gcctcggccc atgagtgccg ggtgttgacg gacctgctgg acgggcaccg gatcgccgat      1380
     ggaaccgcca ccattgtcac gattggccgg ggtgagcggg acaaactggc gggcgacggg      1440
     gtgctggcgc gcctgcaagc cttgggcgtg caggtgatcc cggacctttg ctggtgttcg      1500
     gtgactgaac cggtgctgcc gcctgcgacc cgcacgataa tgaccaattc gggcaaatac      1560
     gcccattacg ggccgggcct gtcgggccgc gccatgcggt tcggcagcct tgcgcactgc      1620
     gccgaggcgg cgctgactgg atacgcgccg gggcgtcccg gctggatcaa cgggcaggac      1680
     agggtataa                                                              1689
//

If you have problems or comments...

PBIL Back to PBIL home page