(data stored in ACNUC7421 zone)

EMBL: CP000031.PE599

CP000031.PE599       Location/Qualifiers
FT   CDS_pept        627307..629085
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0608"
FT                   /product="sugar ABC transporter, periplasmic sugar-binding
FT                   protein"
FT                   /note="Assignment partly based on location in sugar
FT                   transporter operon."
FT                   /db_xref="EnsemblGenomes-Gn:SPO0608"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93923"
FT                   /db_xref="GOA:Q5LVT7"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="InterPro:IPR014597"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LVT7"
FT                   /protein_id="AAV93923.1"
FT                   /translation="MPQSISGIADNREEKMRRYLLSAAAVCAVVAGQAAYADEAAAKKW
FT                   IDEEFQPSVLSKDEQMAEMQWFIKAAEPYAGMEINVLSEGIPTHSYESEVLTKAFEEIT
FT                   GIKVNHQILGEGEVVQAVQTQMQTKRNLYDAYVNDSDLIGTHSRLQLAYNLTDMMAGDF
FT                   KDVTNPGLDLGDFMGTQFTTGPDGDLYQLPDQQFANLYWFRKDWFDREDLKAAFKAKYG
FT                   YELGVPVNWSAYEDIAEFFSEDVKEIDGTAIYGHMDYGKRAPDLGWRMTDAWLSMAGAG
FT                   SKGEPNGIPIDEWGIRMEAGSCNPAGASVTRGGAANGPAAVYAIRKWDEWLRKYAPPGA
FT                   ASYDFYQSLPALAQGNVAQQIFWYTAFTADMVKPQSEGNNTVDGDGNPLWRMAPSPHGP
FT                   YWEDGQKVGYQDVGSWTILNSTPLDRAQAAWLYAQFVVSKTVDVKKSHVGLTFIRDSSV
FT                   NHESFSERAAKLGGLVEFYRSPDRVRWSPTGINVPDYPKLAQIWWQQIGDVNSGAFTPQ
FT                   EAMDRLAFEMDTVMARMQAADEAANVYGGCGPRLNEEKDAEWWFANGGAKPKLDNEKPQ
FT                   GETVNYDELVARWAKN"
     gtgccacaga gcatttctgg cattgcagac aacagggagg aaaagatgcg caggtatctt        60
     ttgtccgctg ccgcggtatg cgccgtggtc gcgggacagg cagcctatgc cgacgaggcc       120
     gctgccaaga aatggattga cgaagagttc cagccctcgg tcctgtccaa ggacgagcaa       180
     atggccgaga tgcaatggtt catcaaggcg gccgagcctt atgccggcat ggaaatcaac       240
     gtgctgtccg agggcattcc gacgcacagc tacgaatccg aggtgctgac caaggccttc       300
     gaggaaatca ccggcatcaa ggtgaaccac cagatcctgg gcgagggcga ggtcgttcag       360
     gccgtgcaga cccagatgca gaccaagcgg aacctgtatg acgcctatgt caacgattcc       420
     gacctgatcg gcacccattc gcgcctgcaa ctggcctata acctgaccga catgatggcg       480
     ggcgatttca aggacgtgac caaccccggt ctcgacctgg gtgatttcat gggcacccag       540
     ttcaccaccg gtcccgatgg cgatctgtac cagctgcccg accagcaatt cgccaacctc       600
     tactggttcc gcaaggactg gttcgaccgc gaggacctga aggcggcgtt caaggccaaa       660
     tacggctatg agctgggtgt gccggtcaac tggtcggcct atgaggatat cgccgagttc       720
     ttcagcgaag acgtcaagga aatcgacggt accgcgatct atggccacat ggattacggc       780
     aagcgcgcgc ccgacctcgg ctggcggatg accgatgcct ggttgtcgat ggccggtgcc       840
     gggtccaagg gtgaacccaa cggtatcccg atcgacgaat ggggtatccg catggaggcc       900
     ggttcgtgca acccggccgg tgccagcgtg acccgcggtg gcgcggcaaa cggcccggcg       960
     gcggtctatg cgatccgcaa atgggacgaa tggctgcgta aatacgcgcc tccgggtgcg      1020
     gcgtcttatg acttctacca gtcgctgccg gcgctggcac aaggcaacgt ggcccagcag      1080
     atcttctggt acaccgcctt taccgccgac atggtcaagc cgcagtccga aggcaacaac      1140
     accgtggatg gtgacggcaa cccgctgtgg cggatggcgc ccagcccgca tggcccctat      1200
     tgggaagacg gccagaaggt cggctatcag gacgtgggat cgtggaccat cctcaactcc      1260
     accccgctgg atcgtgcaca ggcggcctgg ctctatgccc agttcgtggt ctccaagacc      1320
     gtcgacgtga agaaaagcca tgttggtctg accttcatcc gcgacagctc ggttaatcac      1380
     gagagcttct cggaacgcgc ggcgaaactg ggtggcctgg tggaattcta ccgctcgccc      1440
     gaccgggtgc gctggtcgcc caccggcatc aacgtgccgg attacccgaa gctggcccag      1500
     atctggtggc agcagatcgg cgacgtgaac tctggtgcct ttaccccgca agaggcgatg      1560
     gaccgtctgg cgttcgaaat ggacaccgtg atggcccgga tgcaggcagc ggacgaggcg      1620
     gcgaatgtct atggtggctg cggcccgcgc ctgaacgaag agaaggacgc ggaatggtgg      1680
     ttcgccaatg gcggcgccaa gcccaagctg gacaacgaaa agccgcaggg cgagaccgtc      1740
     aactatgacg agctggttgc ccgctgggcc aagaactga                             1779
//

If you have problems or comments...

PBIL Back to PBIL home page