(data stored in ACNUC7421 zone)

EMBL: CP000031.PE6

CP000031.PE6         Location/Qualifiers
FT   CDS_pept        complement(4536..5693)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0006"
FT                   /product="oxygen-independent coproporphyrinogen III
FT                   oxidase, putative"
FT                   /note="identified by match to protein family HMM PF04055;
FT                   match to protein family HMM PF06969; match to protein
FT                   family HMM TIGR00539"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0006"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93337"
FT                   /db_xref="GOA:Q5LWF8"
FT                   /db_xref="InterPro:IPR004559"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010723"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR034505"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWF8"
FT                   /protein_id="AAV93337.1"
FT                   /translation="MADDWQHGGFGLYVHWPFCQAKCPYCDFNSHVAREIDQKAWVRAY
FT                   VSELERCAAELPGRVLNTIFFGGGTPSLMMPETVAAVIETVRRLWPTSNDMEITLEANP
FT                   GSVEAGRFAAYRDGGVNRISMGVQALNDRDLHRLGRIHSVAEARAAFDIARRCFERVSF
FT                   DLIYARQDQTPEAWRAELNEALAMAVDHLSLYQLTIEDGTAFGDRYARGKLRGLPADDD
FT                   AADMYLITQEVCATHGLPAYEVSNHARPGSESRHNLIYWRYGDYVGIGPGAHGRITVDG
FT                   QRFATESPLNPGAWLGAVAKGSGELSRVALSLQDQADEYLMMGLRIAEGLDIHRYEALS
FT                   PQPLNRNRLAHLTELGMIEIEGTRLKATAQGRAVLNAVILDLMSE"
     ttggcggatg actggcagca tgggggcttt ggcctctacg tgcattggcc cttttgccag        60
     gccaagtgtc cctattgcga cttcaacagc catgttgccc gtgaaatcga ccagaaagcc       120
     tgggttagag cctatgtttc cgaacttgaa cgctgtgccg ctgagctgcc gggccgggtt       180
     ctgaacacca tcttttttgg cggcggtacc ccgtcgctga tgatgccgga aacggtcgcg       240
     gcagtgatcg aaaccgtccg ccgtctctgg cccacctcca acgacatgga aatcacgctc       300
     gaggccaatc ccggctcggt tgaggccggg cgctttgccg cctatcgcga tggcggggtc       360
     aaccggatct cgatgggggt gcaggcgctg aacgaccggg acctgcaccg gctgggccgc       420
     atccacagcg tggccgaggc gcgggcagct ttcgacattg cgcggcgctg ttttgagcgg       480
     gtcagtttcg acctgatcta tgcccggcag gaccagacac ccgaagcgtg gcgtgccgag       540
     ttgaacgagg cgctggccat ggcggtcgat cacctgtcgc tctaccagtt gacgatcgag       600
     gacggcaccg cctttggcga ccgctatgcc cgcggcaagc tgcgcggcct acccgccgat       660
     gacgacgccg ccgacatgta cctgatcacg caagaggtct gcgccacgca tggcctgccc       720
     gcctacgagg tctcgaacca cgcccgcccc ggttcggaat cgcgccacaa cctgatctat       780
     tggcgctatg gcgattatgt cggcatcggc cccggcgcac atggtcgcat caccgtggat       840
     ggccagcgtt tcgccaccga aagcccgctg aaccctggcg cctggctggg cgcagtggca       900
     aagggaagtg gtgagttgag ccgagtagcc ctctcgctac aagatcaagc cgacgaatac       960
     ctgatgatgg ggcttcgtat tgccgaagga ctagatatcc accgatacga ggcgctttcg      1020
     ccgcagcccc taaaccggaa ccgccttgcc catttgaccg aactgggcat gatcgagatc      1080
     gaaggtacgc ggctgaaggc caccgcccag gggcgtgcgg tgctgaacgc ggtcattctg      1140
     gacctgatgt cggagtag                                                    1158
//

If you have problems or comments...

PBIL Back to PBIL home page