(data stored in ACNUC9435 zone)

EMBL: CP000031.PE601

CP000031.PE601       Location/Qualifiers
FT   CDS_pept        630272..631357
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0610"
FT                   /product="sugar ABC transporter, ATP-binding protein"
FT                   /note="Assignment partly based on location in sugar
FT                   transport operon."
FT                   /db_xref="EnsemblGenomes-Gn:SPO0610"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93925"
FT                   /db_xref="GOA:Q5LVT5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LVT5"
FT                   /protein_id="AAV93925.1"
FT                   /translation="MAKITLSKLRHSYYPNPKTPDDYALKEIDLDWTDGGAYALLGPSG
FT                   CGKSTLLNIISGLLVPSEGRILFDGQDVTELPPDKRNIAQVFQFPVIYDTMTVYDNLAF
FT                   PLRNRGRDEATVRERVTAIAEMLELSDLLNRKAAHLSPDNKQKISMGRGLVRQDVNVVM
FT                   FDEPLTVIDPHLKWKLRSKLKELHQRVRATMIYVTHDQTEALTFADQVVVMQEGEVVQI
FT                   GTPVELFDRPAHTFVGHFIGSPGMNILPAEVSGGVAHFAGQAIPLEGPITAAPGARTEI
FT                   GIRPEFVSLGLSGLPATVTKVSDVGRHTVVECEVAGSRVNAIVTGSGPEKGAMVQLEFR
FT                   RDQTRLYADGWLASEAAEGAA"
     atggcgaaaa ttacactctc caagctgcga cacagctatt atccgaaccc gaaaacgccc        60
     gatgactacg cgttgaagga gatcgacctc gactggaccg atggtggcgc ctatgcgctg       120
     cttggcccct cgggctgtgg aaagtccacg ctgctgaaca tcatctcggg cctgctggtc       180
     ccgtccgagg ggcggatcct gttcgatggg caggatgtga ccgaactgcc gcccgacaag       240
     cgcaacatcg cgcaggtgtt ccagtttccg gtgatctacg acacgatgac cgtctacgac       300
     aacctcgcct ttcccctgcg caaccggggc cgggacgagg ccacggtgcg cgagcgggtc       360
     accgcgattg ccgagatgct ggagctgtcc gacctgctca accgcaaggc cgcgcatctg       420
     agcccggaca acaagcagaa gatctcgatg gggcgcgggc tggtgcgtca ggacgtgaac       480
     gtggtgatgt tcgacgaacc gctgaccgtg atcgacccgc atctgaaatg gaagctgcgc       540
     tccaagctga aggaactgca ccagcgggtg cgcgccacca tgatctatgt gacccatgac       600
     cagaccgagg cgctgacatt cgccgatcag gtggtggtga tgcaagaggg cgaggtggtg       660
     cagatcggca ccccggtcga actgttcgac cggcccgcgc atacgttcgt gggccatttc       720
     atcggctcgc ccggcatgaa catcctgccc gccgaagtgt cgggtggggt ggcgcatttt       780
     gccggtcagg cgatcccgct cgaagggccg atcaccgccg cgcccggcgc ccggaccgag       840
     atcggcatcc gccccgagtt tgtctcgctt ggcctgtcgg gcctgcctgc cacggtgacc       900
     aaggtctcgg atgtggggcg gcacacggtg gtcgaatgcg aggtcgcggg cagccgcgtc       960
     aatgccatcg tcaccgggtc tggccccgaa aagggcgcaa tggtgcaact ggaattccgc      1020
     cgcgaccaga cccggcttta cgccgatggc tggctggcga gtgaggccgc ggagggcgcc      1080
     gcatga                                                                 1086
//

If you have problems or comments...

PBIL Back to PBIL home page