(data stored in ACNUC7421 zone)

EMBL: CP000031.PE606

CP000031.PE606       Location/Qualifiers
FT   CDS_pept        633777..634910
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0615"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to GB:CAD73596.1"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0615"
FT                   /db_xref="EnsemblGenomes-Tr:AAV97129"
FT                   /db_xref="GOA:Q5LVT0"
FT                   /db_xref="InterPro:IPR008756"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LVT0"
FT                   /protein_id="AAV97129.1"
FT                   /translation="MDGEVLLNAYLDLNLLLVAGVAIWSLLRWAVAKTRLGTAYMPQLR
FT                   LLNGLTVLLVASPLLAMAITTWIVAHPPNIPDLLVRQYLHGNVGLSASQFEALLGLRED
FT                   MVRALLAQHEVWAQVVAAAFLAGALFCTLHMGLSVLRLSNSLRGAHLWKRIGRVHLLVS
FT                   DTARVAYSTRGLRNRYVVLPSALLEAPQDLRMTVAHELQHFRQSDIECEFLLELLRPLL
FT                   FWNPAFFLWRRQVRMLREYACDQALMARPHFDMRAYCECLFRACRVAAQNRVLFARTTP
FT                   TVALVDRRETRRPSTLHSRIEALTATRQDTAGPTAWLLISGLLVASVLSTMLVMQRSSD
FT                   WSHDRIMLSTIVNLERMAQRNATVASPFQGGFVVATD"
     atggacggtg aagttcttct caatgcctat cttgatctga accttctgct ggtcgcgggt        60
     gtcgcgatct ggtcgctgct ccgatgggcg gtggcgaaaa cccggctggg tacggcctat       120
     atgccgcagc tgcggctgct gaacgggctg acggtgctgc tggtggcctc gccgctgctg       180
     gcgatggcga tcaccacctg gatcgttgcc catcccccca atattcccga cctgctggtg       240
     cgccagtacc tgcatggcaa tgtcggcctc agcgccagcc agttcgaggc gcttctgggc       300
     ctgcgcgagg atatggtgcg cgccctgctg gcccagcacg aggtctgggc tcaggtggtg       360
     gcggcggcct ttctggccgg tgcgctgttt tgtaccctgc atatgggcct gtcggtcttg       420
     cggttgagca acagcctgcg cggcgcccat ctgtggaagc ggatcgggcg ggtgcacctt       480
     ttggtcagcg ataccgcccg tgtcgcctat tccacccgtg ggttgcgtaa tcgctatgtg       540
     gtgctgccct cggcgctgct cgaggcgccc caggacctgc gcatgaccgt cgcacacgag       600
     ttgcagcatt tccgccagag cgacatcgaa tgcgagttcc tgcttgaact gctgcgcccg       660
     ctcttgttct ggaacccggc ctttttcctg tggcgccgcc aggtgcggat gctgcgggaa       720
     tacgcctgcg atcaggcgct gatggcgcgg ccgcatttcg acatgcgcgc ctattgcgaa       780
     tgcctgttcc gtgcctgccg cgtggcggcg cagaaccggg tgctgttcgc ccgcaccacg       840
     cccacggtgg cgttggtcga ccggcgcgag acgcgccgcc cctcgaccct gcacagccgg       900
     atcgaggcgc tgaccgcgac ccgccaggac acggcggggc cgactgcctg gctgttgatc       960
     tcgggcctgc tggtggcctc ggtcctgagc acgatgctgg tgatgcagcg ctcgtccgac      1020
     tggagccatg atcgcatcat gctgtcgacc atcgtcaatc tcgaacgcat ggcccagcgc      1080
     aacgcaaccg tcgccagccc gttccagggc ggttttgtgg tggcaaccga ctga            1134
//

If you have problems or comments...

PBIL Back to PBIL home page