(data stored in ACNUC9435 zone)

EMBL: CP000031.PE609

CP000031.PE609       Location/Qualifiers
FT   CDS_pept        637521..638717
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0619"
FT                   /product="sterol desaturase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0619"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93932"
FT                   /db_xref="GOA:Q5LVS7"
FT                   /db_xref="InterPro:IPR006694"
FT                   /db_xref="InterPro:IPR019223"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LVS7"
FT                   /protein_id="AAV93932.1"
FT                   /translation="MEDQCIISHLAGIFSGVLATDFLRYAVGAGGVYLTVNLALAARLR
FT                   ARKIRAYEPPKGQIGREILASLRTVLIFALNGTLIVVGAEAGLVPIYREIATHGWAYLF
FT                   FSTTVLIVAHDTWFYWSHRLLHYPPIFRRFHRLHHKSHNPTPFTSYSFDLGEAVVNAIY
FT                   LPLILLVLPAHPVAILVFVTHMMLRNAIGHSGYEIFPANRRGKPLFDWITTVTHHDLHH
FT                   AHAGYNLGLYFTWWDRLMGTEHPDYHEAFQKVAKPASWPSVRAVILAFAIFTGIAVSDA
FT                   RAERLSGAYASPGFGVIVRFEPCNANPGLTCGRMIWAWDAAEVPHAQSGDVIVIDLHGD
FT                   GNVWSGRLKNPENGRMYRGSVVQRSPDTIVLRGCAGPFCTSQIWHSVRALRRALESAE"
     atggaagatc aatgcattat cagtcatctc gccgggattt tctccggcgt tcttgccacg        60
     gactttctgc gctacgccgt cggtgcaggt ggcgtttacc tgaccgtgaa tctggcgctg       120
     gcggctcggc tccgggcgcg gaagatccgg gcctatgagc cgccgaaagg ccagatcggc       180
     cgcgaaatcc tcgcaagcct gcgaacggtt ctgatctttg ccctgaacgg aacgttgatc       240
     gttgtcggag cggaggcggg actcgtcccc atctataggg aaatcgccac ccacggctgg       300
     gcctatctct tcttcagtac gacggttctg atcgtcgccc atgatacgtg gttctattgg       360
     tcgcacaggc ttctgcacta cccgccgatc ttccggcgct ttcacaggct gcaccacaag       420
     tcgcacaacc cgacgccctt tacctcctac agttttgatc tgggcgaggc ggtagtgaat       480
     gcgatctacc tgccgctgat cctgcttgtc ctgcccgcgc atccggtggc gatcctggtg       540
     ttcgtcaccc atatgatgtt gcggaatgcg atcgggcact ctggctatga aatctttccg       600
     gcaaaccggc gcggcaaacc gctctttgac tggataacca ccgtcaccca ccatgacctg       660
     caccacgccc acgccggata caacctcggc ctttacttca catggtggga ccggctgatg       720
     ggaacagagc atccggatta tcacgaagcc ttccaaaaag tggccaaacc tgcctcatgg       780
     ccatcggtcc gcgccgtgat actcgctttc gcgatcttta ccggtatcgc ggtgtctgac       840
     gcacgtgcag aacgtctgtc cggggcctac gcatcgcccg gcttcggcgt catcgttcgg       900
     ttcgagcctt gcaacgccaa cccgggtctg acttgcggcc ggatgatctg ggcctgggac       960
     gctgccgaag tgccccatgc ccagtcaggg gacgtcattg tcatagacct gcacggcgac      1020
     gggaatgtct ggtccggtcg gctgaagaac cccgaaaacg ggcgcatgta ccgtggttcg      1080
     gtagtccaac gcagccctga cacgattgta ctgcgcggct gcgccggacc tttctgcact      1140
     tcgcagattt ggcattccgt tcgcgcgctg aggcgcgccc tggaaagcgc cgaatag         1197
//

If you have problems or comments...

PBIL Back to PBIL home page