(data stored in ACNUC9435 zone)

EMBL: CP000031.PE610

CP000031.PE610       Location/Qualifiers
FT   CDS_pept        638751..639377
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0620"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to GB:BAC91031.1"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0620"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93933"
FT                   /db_xref="GOA:Q5LVS6"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LVS6"
FT                   /protein_id="AAV93933.1"
FT                   /translation="MSKPEFIARQGRKPTGWLGHIVARVMARETRPENDRALSFLDLAD
FT                   GDSLIDIGCGHGETLFQADRIVRLSGSVGVDFSEVMLKRARARNRDAVWDTRMAFHCAD
FT                   TAALPFPDKRFGKALSVHTIYFWPNPAAHLAEAFRVLRRGGRFLFCYRSTADRRAVEEF
FT                   PDTVYRFPSVQEVEEKLKLVGFLGPETTTEDIKGRLTHWSIAEKP"
     atgagcaaac ccgagttcat cgcccgccaa ggccgcaagc cgaccggatg gcttggccat        60
     attgtcgccc gcgtcatggc acgagagacc cgcccagaga acgaccgcgc cctgagcttc       120
     ctcgatctgg cagatggcga cagcctcatc gacatcggct gcgggcatgg cgaaacgctt       180
     tttcaggccg accgcattgt gcgtctttca ggcagcgtcg gcgtggattt ctccgaggta       240
     atgctgaagc gtgctcgtgc caggaaccgt gatgcggtct gggacacgcg catggcgttt       300
     cattgtgcgg acactgctgc gctgcccttt ccggacaagc ggttcggcaa ggcgctttcg       360
     gtgcatacga tctatttctg gccgaacccg gcggcccatc ttgccgaggc gttccgcgtt       420
     ttgcgccgag gagggcgctt cttgttttgt taccgatcga ctgctgacag acgggccgtg       480
     gaagagttcc cggacactgt ctaccgtttc ccgagcgttc aggaagtgga ggagaagttg       540
     aagctggtcg ggttcctggg ccccgagacc acaactgagg acatcaaagg acgcctgacg       600
     cattggagta tcgcggagaa gccgtga                                           627
//

If you have problems or comments...

PBIL Back to PBIL home page