(data stored in ACNUC7421 zone)

EMBL: CP000031.PE614

CP000031.PE614       Location/Qualifiers
FT   CDS_pept        complement(643540..644166)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0624"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to PIR:B75629"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0624"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93936"
FT                   /db_xref="GOA:Q5LVS2"
FT                   /db_xref="InterPro:IPR021122"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LVS2"
FT                   /protein_id="AAV93936.1"
FT                   /translation="MRKYGRPYHLPTSPGVMSDDKILRDLSVLTAATEVVFTEKMDGEN
FT                   TTIYQGGCHARSPDSGYHASRDWMKAFAAVISPSLAENERIVGEYLFARHSVAYDNLNS
FT                   YFLGFAWIVDGTVKTWDSTVERFNILGIQPVSVLHRGSFSDAAVNAVLADLDLSKQEGF
FT                   VVRTTSEFSETNMGTCMAKYVRADHVQSETHWMNAEITRNGLKKA"
     atgagaaaat atggccgacc gtatcacctc cctacttccc caggcgtcat gagcgacgac        60
     aaaatcctcc gggatctgtc cgtcctgacc gccgccaccg aagttgtttt caccgagaaa       120
     atggatggcg agaataccac aatctatcaa ggtgggtgcc atgcccgcag cccagacagc       180
     ggctatcatg catcacgcga ttggatgaaa gcgtttgcgg cagtgatctc gccaagcctt       240
     gccgaaaacg aacggatcgt gggcgaatat ttgtttgcac gccactcagt cgcatacgac       300
     aacttgaatt cctattttct aggctttgcg tggatcgttg atggcacagt aaaaacttgg       360
     gattccacag tggagcgttt caacatcctc ggaatccagc cggtatcggt cctgcatcgt       420
     gggtcattca gtgacgcagc cgtcaacgca gtactggctg atctagacct aagcaaacag       480
     gaaggctttg tcgtcagaac aacctcagaa ttctccgaaa caaacatggg aacctgtatg       540
     gccaaatatg ttcgtgctga tcatgtgcag agtgaaacgc attggatgaa tgctgaaatt       600
     acccgaaacg ggctaaagaa agcataa                                           627
//

If you have problems or comments...

PBIL Back to PBIL home page