(data stored in ACNUC7421 zone)

EMBL: CP000031.PE618

CP000031.PE618       Location/Qualifiers
FT   CDS_pept        complement(652364..652888)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0631"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0631"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93939"
FT                   /db_xref="GOA:Q5LVR9"
FT                   /db_xref="InterPro:IPR010466"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LVR9"
FT                   /protein_id="AAV93939.1"
FT                   /translation="MTSFNSFMRPLAAAILSALVTLAPVAPQAQEAVRGAVTNLPIPRF
FT                   VSMKANEGNVRRGPSLTHRIDWVFKRRDMPLQITAEHGHWRKVQDRDGAGGWVHYALLS
FT                   GVRTVLVEKDMMPLYARPDPASQVAAHFEMGVVARLGTCTQDWCRISAGGYRGWAPKEN
FT                   LWGVGTDEIRE"
     gtgacaagtt tcaacagttt catgcgcccc ctcgcggcgg cgatcctctc ggctttggtg        60
     accctggcgc ccgtcgcgcc acaggcccag gaggccgtgc gcggagcggt gaccaatctg       120
     ccgattcccc gctttgtctc gatgaaggcg aacgagggca atgtgcggcg cggcccctcg       180
     ctgacgcatc gcatcgactg ggtgttcaag cggcgcgaca tgccgttgca gatcaccgcc       240
     gagcacggcc attggcgtaa ggtccaggac cgcgatggcg ccggcggctg ggtccactac       300
     gcattgctgt cgggcgtgcg cacggttctg gtggaaaagg acatgatgcc gctatacgcc       360
     cgccctgacc cggcctcgca ggtcgcggcc catttcgaga tgggcgttgt ggcccggctg       420
     gggacctgca cacaggactg gtgccgaatc tctgccggcg gctatcgcgg ctgggcgccg       480
     aaagagaacc tgtggggtgt cggcaccgac gagatccgcg aataa                       525
//

If you have problems or comments...

PBIL Back to PBIL home page