(data stored in ACNUC9435 zone)

EMBL: CP000031.PE619

CP000031.PE619       Location/Qualifiers
FT   CDS_pept        653026..654012
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0632"
FT                   /product="D-isomer specific 2-hydroxyacid dehydrogenase
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0632"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93940"
FT                   /db_xref="GOA:Q5LVR8"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR029752"
FT                   /db_xref="InterPro:IPR029753"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LVR8"
FT                   /protein_id="AAV93940.1"
FT                   /translation="MPRERLSVVVTRRLPEVVETRLSELFNVRLRDDDTPMSRDELAAA
FT                   LREADVLVPTLNDRIDAGLLAQAGERMRLIANYGAGVDHIDVATARQRGILVSNTPGVL
FT                   TDDTADMTMALILAVTRRIPEGLAVMQKNEWTGWAPTALLGGRVGGRRLGILGMGRIGQ
FT                   AVARRASAFGMQIHYHNRRRLRPEVEDALEATWWDSLDQMIARMDVISVNCPSTPSTFH
FT                   LMNARRLKLMKPTGVIVNTSRGEVIDENALTRMIRTGEIAGAGLDVYEHGTQVNPRLRE
FT                   LPNVVLLPHMGSATLEGRIEMGEKVIINIKTFADGHRPPDQVVPAML"
     gtgccaagag aacgtctgag tgttgtcgtt acgcgacggt tgcccgaggt ggtggaaacc        60
     cgcttgagcg aactgttcaa tgtccgcctg cgggatgacg acacgccaat gtcgcgcgac       120
     gagctggccg cggcgctgcg cgaagccgat gtgctggtgc cgacgctgaa cgaccgcatc       180
     gacgcgggcc tgctggcgca ggcgggcgag cggatgcggc tgatcgccaa ttacggggcg       240
     ggggtcgatc acattgatgt ggccacggcg cgccagcgcg gcattctggt gtcgaacacg       300
     cccggcgtgc tgaccgacga caccgccgac atgaccatgg cgctgattct cgctgtcacc       360
     cgccgcatcc ccgaggggct ggcggtgatg caaaagaacg aatggaccgg ctgggcgccc       420
     accgcgctct tgggcgggcg tgtcggcggc cgtcgcctgg gcatcctggg catggggcgg       480
     atcggtcagg cggtcgcccg gcgcgccagc gcctttggca tgcagatcca ttatcacaac       540
     cgccgccgct tgcgccccga ggtcgaggat gcgctggaag cgacctggtg ggacagtctg       600
     gatcagatga tcgcgcggat ggacgtgatc tcggtcaact gtccgtcgac gccctcgacc       660
     tttcatctga tgaacgcgcg acggctgaag ctgatgaagc ccaccggcgt catcgtcaac       720
     acctcgcgtg gtgaggtgat cgacgaaaac gcgctgaccc gaatgattcg tacaggcgaa       780
     atcgcggggg cggggctcga cgtctacgaa catggcaccc aggtgaaccc gcgcctgcgc       840
     gaattgccca atgtcgtgct gctgccgcat atgggctcgg ccacgctgga aggccggatc       900
     gagatgggcg agaaggtgat catcaacatc aaaaccttcg ccgatggtca ccggcccccg       960
     gatcaggtgg tgcctgcgat gctgtaa                                           987
//

If you have problems or comments...

PBIL Back to PBIL home page