(data stored in ACNUC7421 zone)

EMBL: CP000031.PE622

CP000031.PE622       Location/Qualifiers
FT   CDS_pept        657753..660260
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0635"
FT                   /product="aminomethyl transferase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0635"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93943"
FT                   /db_xref="GOA:Q5LVR5"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR006222"
FT                   /db_xref="InterPro:IPR013977"
FT                   /db_xref="InterPro:IPR027266"
FT                   /db_xref="InterPro:IPR029043"
FT                   /db_xref="InterPro:IPR032503"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LVR5"
FT                   /protein_id="AAV93943.1"
FT                   /translation="MKTQVKALVVGGGAVGTSIAYHLAKAGWNDVMLIERDELTSGSTW
FT                   HAAGLLPLFNMSYATTHIHQYSVDFYKTLEEETGLNAGFAVVGNLRMAQTQDRMDEYML
FT                   YASTAETCGVKYEWLTPDQIKERWPLIETSDLKGAIYHTEDGYINPADVTQAMAKGARQ
FT                   RGVDIVRKMQADAFHWNGTHWEVTCTKMVEKGGNLVPSDEQVVITAEHVVTASGNHAQR
FT                   TAKLLGIKMPAIPVEHTFIVMDQDPELVKWREAGNPEHPVVRDADNESYAREERGGWIL
FT                   GIYEHGAPARFEYGVPDSFRADLFPLDLDRIADQYMAMAERVPSCAESGLKDDFNGPIC
FT                   YTPDGNPLVGPAPGLRNMWLAEGFSFGITAAGGTGYYLAQMMVDGEAEIDMASLDPKRY
FT                   SSNWMTTEFAARKNEECYSHVYILHHPDEEREACRPLRTAPAYDRQKALGAQFGFVNGW
FT                   ERPNYYGPLDAPENFDHDARSFRRGGWWQYAVEEAKAIRNGVGLIDATAFTKHVVKGPG
FT                   ATQFLDWFTCNKLPKVGRINLTYALTSAGTTRTEYTIVRNGENNYYIVSAGAWTEYDAD
FT                   FLRKAAEDKMEEFGYIEIQDVTTQWGVFAIAGPKSRDVLKEVIKDADPETALSNKRFPW
FT                   LSARQIELGMCPVNAIRVAYTGELGWELHHPIEMQRYLWDLLLAAGEKHGMKLVGARAQ
FT                   NWLRQEKSYRAFGTELGRDATPLEADLPRFVDLGKDFHGKAEMEAKGIRSKCCTLLIDG
FT                   PSDADPWGREALYTPEGARVGRLTSGGYSVAFEKSIGMGYVKPELAVEGTKLKVKMLDQ
FT                   LWDAVVTCDSPYDPKNETIRKDG"
     atgaaaaccc aagtcaaagc actggtcgtc ggcggcggtg ccgttggcac ctcgatcgcc        60
     taccatctgg ccaaggcggg ctggaacgat gtcatgctga tcgagcggga cgagctgacc       120
     tccggctcga cctggcacgc ggcgggtctg ctgccgctgt tcaacatgtc ctatgcaacc       180
     acccatatcc accagtactc ggtcgatttc tacaagaccc tggaagagga aaccggcctg       240
     aatgccggtt tcgccgtggt cggcaacctg cgcatggcgc aaacgcagga tcgtatggac       300
     gagtatatgc tctatgcctc gaccgccgag acctgcggcg tgaaatacga atggctgacc       360
     ccggaccaga tcaaggaacg ctggccgctg atcgagacct cggacctcaa gggcgcgatc       420
     tatcacaccg aggacggcta tattaacccc gccgacgtga cccaggcgat ggccaagggt       480
     gcacgccaac gcggcgtgga tatcgtgcgc aagatgcagg ccgatgcctt ccactggaac       540
     ggcacccact gggaagtcac ctgcaccaag atggtggaaa agggcggcaa cctggtgccc       600
     tccgacgaac aggttgtgat caccgccgag catgtggtca ccgcatcggg caaccatgcg       660
     cagcgcaccg ccaagctgct gggcatcaag atgcccgcga tcccggtcga gcacacgttc       720
     atcgtcatgg atcaggaccc cgagctggtc aaatggcgcg aggcgggcaa cccggaacac       780
     cccgtcgtgc gcgatgccga caacgaatcc tatgcccgcg aggaacgcgg cggctggatc       840
     ctgggcatct acgagcacgg cgcgcccgcg cggttcgaat acggcgtgcc tgacagtttc       900
     cgcgccgacc tgttcccgct cgatctggac cggatcgccg atcagtacat ggcgatggcc       960
     gagcgcgtgc cctcttgcgc cgaaagcggc ctcaaggacg atttcaacgg cccgatctgc      1020
     tacacccccg atggcaaccc gctggtcggc ccggcgccgg gcctgcgcaa catgtggctg      1080
     gccgaaggct tctcctttgg catcaccgcc gcgggcggca ccggctatta cctggcccag      1140
     atgatggtcg acggcgaggc tgagatcgac atggcctcgc tcgaccccaa gcgctacagt      1200
     tcgaactgga tgaccaccga gttcgcggcg cgcaagaacg aggaatgcta tagccacgtc      1260
     tatatcctgc accacccgga tgaagagcgc gaggcctgcc gcccgctgcg caccgcgccc      1320
     gcctatgacc ggcagaaggc gcttggcgcg cagttcggtt tcgtcaacgg ctgggaacgc      1380
     cccaactatt acggcccgct cgatgcgccc gagaatttcg accatgacgc gcgcagcttc      1440
     cgccgtggcg gctggtggca atatgcggtg gaagaggcca aggcgatccg caacggcgta      1500
     ggcctgatcg acgccaccgc ctttaccaag cacgttgtca agggccccgg cgccacccag      1560
     ttcctggatt ggttcacctg caacaagctg ccgaaagtgg gccggatcaa cctgacctat      1620
     gcgctgacca gcgccggcac cacccgcacc gaatacacca tcgtgcgcaa tggcgagaac      1680
     aactactata tcgtctccgc cggggcctgg acggagtatg acgccgactt cctgcgcaag      1740
     gcggccgagg acaagatgga ggagttcggc tatatcgaga tccaggatgt caccacccag      1800
     tggggcgtct ttgccatcgc tgggcccaaa tcgcgcgacg tgctgaaaga ggtgatcaag      1860
     gacgccgatc ccgaaaccgc gctgtccaac aagcgtttcc cgtggctgtc ggcacgtcag      1920
     atcgaattgg gcatgtgccc cgtgaacgcg atccgtgtgg cctatacggg tgagctgggc      1980
     tgggaattgc atcacccgat cgagatgcag cgctacctgt gggacctgct gctggctgcc      2040
     ggtgaaaaac acgggatgaa gctggttggc gcccgcgccc agaactggct gcggcaggag      2100
     aagagctatc gcgcgtttgg caccgaactg ggccgtgacg cgaccccgct cgaggccgat      2160
     ctaccgcgtt tcgtggacct tggcaaagac ttccacggca aggccgagat ggaggccaag      2220
     ggcatccgct cgaaatgctg caccctgctg atcgacggcc cgtcggacgc cgatccctgg      2280
     ggccgtgagg cgctctatac ccccgaaggc gcgcgcgtcg ggcgcctgac atcgggcggc      2340
     tattcggtgg ccttcgaaaa gtcgatcggc atgggctatg tgaagcccga actggcggtc      2400
     gaaggcacga agctgaaggt caagatgctc gatcagcttt gggatgcggt cgtgacctgc      2460
     gacagcccct atgaccccaa gaacgagacc atccgcaagg acggctga                   2508
//

If you have problems or comments...

PBIL Back to PBIL home page