(data stored in ACNUC7421 zone)

EMBL: CP000031.PE625

CP000031.PE625       Location/Qualifiers
FT   CDS_pept        complement(661052..661669)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0638"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to GB:AAO90814.1"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0638"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93946"
FT                   /db_xref="GOA:Q5LVR2"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LVR2"
FT                   /protein_id="AAV93946.1"
FT                   /translation="MEQATRKARMLDKSQKPTWTSFEEATQADWDAVMEYEEAYNAALP
FT                   ERILDAIRSLDEAWTPYPINRFQHCLQAATRAHADGAEDEIVVAALVHDVGDILSPYNH
FT                   GELAAAMMKPYVSEKCHWILQHHCVFQGYYYNHYWGGDRNARDKYRDSPYWEDARYFCH
FT                   EYDQCAFDPDYPTKPLEFFEPILRRVLSRGGGHMELNETAEG"
     ttggaacaag caacaaggaa agcgcgcatg ctggacaaat cacaaaaacc cacctggacc        60
     agtttcgaag aggccaccca ggccgattgg gacgcggtga tggaatatga agaggcctat       120
     aacgccgccc tgcccgagcg gatactggac gcgatccgct cgctggacga ggcctggacc       180
     ccctatccga tcaaccgctt tcagcattgc ctgcaggccg cgacccgcgc ccatgccgat       240
     ggcgccgagg atgagatcgt ggtggccgcg ctggtgcatg acgtgggcga tatcctgtcg       300
     ccctacaatc atggcgaact ggccgcggcg atgatgaaac cctatgtcag cgagaaatgt       360
     cactggatcc tgcaacatca ttgcgtgttc cagggctatt actacaacca ctattggggc       420
     ggcgaccgca acgcgcgcga caagtatcgc gacagcccct attgggagga cgcgcggtac       480
     ttctgccatg agtacgacca atgcgccttt gacccggact acccgaccaa accgctggag       540
     ttcttcgaac cgatcctgcg ccgggtgctg tcgcgcggtg gcggtcacat ggagctgaac       600
     gagaccgccg aaggataa                                                     618
//

If you have problems or comments...

PBIL Back to PBIL home page