(data stored in ACNUC7421 zone)

EMBL: CP000031.PE628

CP000031.PE628       Location/Qualifiers
FT   CDS_pept        complement(662996..663646)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0641"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to GB:AAP57703.1"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0641"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93948"
FT                   /db_xref="GOA:Q5LVQ9"
FT                   /db_xref="InterPro:IPR010342"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LVQ9"
FT                   /protein_id="AAV93948.1"
FT                   /translation="MSRTPPSVASIATQGDGARMVAPAAERNMAALCDLLAQVARHQGR
FT                   ALELASGTGQHVSAFAARLPGLQWQPTEVDAQRRASIDAYCEALDTVAPAQELNATRPG
FT                   WGADWAGQDLVVLINLLHLISEGEAATLISEAAAALAPGGRLVIYGPFMRAGELTSEGD
FT                   ERFHAALTAQDPEIGYKDDFDIIDRMQEAGLELAEVVEMPANNLALIAEKPRI"
     atgagccgca cgccgccctc ggttgccagt atcgccacgc agggcgacgg cgcacgcatg        60
     gtggcgcctg cggcggaacg caatatggcc gcgctctgcg acctgctagc gcaggtggcc       120
     cggcatcagg gccgcgcgct ggaactggcc agcggcaccg gccagcatgt cagtgccttt       180
     gccgcgcggc tgcccgggct gcagtggcaa ccgaccgagg tggacgcaca acgccgcgcc       240
     agcatcgatg cctattgcga agccctggac actgtcgccc cggcgcaaga gctgaacgcg       300
     acgcgccccg gatggggcgc ggactgggcg ggtcaggatc tggtggtact gatcaacctc       360
     ctccatctga tttccgaagg ggaggctgca accctgatct ccgaggccgc cgcagcgctg       420
     gcgccgggcg ggcggctggt gatctacggc cctttcatgc gggcgggcga attgaccagc       480
     gagggcgacg aacgcttcca cgcggcgctg acggcgcagg acccggaaat cggttacaag       540
     gacgatttcg acatcatcga ccggatgcag gaagccgggc tggagttggc cgaggtggtc       600
     gaaatgcccg ccaacaacct cgctctgatc gccgaaaaac cgcgcatctg a                651
//

If you have problems or comments...

PBIL Back to PBIL home page