(data stored in ACNUC7421 zone)

EMBL: CP000031.PE631

CP000031.PE631       Location/Qualifiers
FT   CDS_pept        665776..666201
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0644"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to GB:BAC48747.1"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0644"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93952"
FT                   /db_xref="GOA:Q5LVQ6"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LVQ6"
FT                   /protein_id="AAV93952.2"
FT                   /translation="MSTSNIHPMASEHLPRYIVAADGSDYLFTVMAVFTVGLILLIGVG
FT                   YFTLHALPERMAHKNNHSQFQLVGILALLALFTHNNVFWVAAVLVAGFQIPDLAAPLRA
FT                   ISDAIRGLGKTEDQGNATPSERAPEPTPHPAAATEGH"
     ttgagtacga gcaacataca tccgatggcc tccgagcatc ttccgcgcta tatcgtggct        60
     gcggatggca gcgattatct gttcaccgtc atggcggtgt tcacggtagg cctgatcctg       120
     ctgatcgggg tcggatattt caccctgcat gccctgccgg aacgcatggc gcacaagaac       180
     aatcattccc agttccagct ggtgggcata ttggcgctgc tggcgctgtt cacccataac       240
     aacgtgttct gggtggccgc ggtgctggta gctgggttcc agatccccga tctggcggcc       300
     cccttgcgcg ccatttccga cgcgatacgc gggcttggca agaccgagga tcagggcaac       360
     gcgaccccgt ccgagcgtgc gccggaacca accccgcatc ccgccgcagc gaccgaaggg       420
     cactga                                                                  426
//

If you have problems or comments...

PBIL Back to PBIL home page