(data stored in ACNUC7421 zone)

EMBL: CP000031.PE64

CP000031.PE64        Location/Qualifiers
FT   CDS_pept        complement(67637..68263)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0064"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to SP:Q8UJ48; match to
FT                   protein family HMM PF02576"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0064"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93395"
FT                   /db_xref="GOA:Q5LWL1"
FT                   /db_xref="InterPro:IPR003728"
FT                   /db_xref="InterPro:IPR028989"
FT                   /db_xref="InterPro:IPR028998"
FT                   /db_xref="InterPro:IPR035956"
FT                   /db_xref="InterPro:IPR036847"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5LWL1"
FT                   /protein_id="AAV93395.1"
FT                   /translation="MTNNLIAKAAIDRRLAEIVSPVIADLGYELVRIRLMSGKSTTLQI
FT                   MADKPDGGIEVDDCAAISNAVSATLDVEDPILDAYTLEVSSPGIDRPLTRLKDFEMFEG
FT                   YEAKIETTEMIDGRRRFRGELAGIEGNEVLINLDQNGETVTIGLEFDWLSDAKLVLTDD
FT                   LIKEMLRQRKAAGVLNEDQFDEIVEEAPETGATTMARDGSEEETK"
     atgaccaaca acctgatagc aaaggccgcc atcgaccggc gcctggccga gatcgtcagc        60
     cccgtgatcg cggatctggg atacgagctg gtgcgcattc gcctgatgag cggcaagagc       120
     accacgcttc agatcatggc cgacaagccc gatggcggca tcgaggtgga cgattgcgcc       180
     gcgatctcga acgcggtcag cgccacgctg gatgtcgagg atccgatcct ggatgcctat       240
     acgctcgaag tgtcgagccc gggcatcgac cggccgctga cccggctcaa ggatttcgag       300
     atgttcgaag gctatgaggc caagatcgaa acgaccgaga tgatcgacgg ccgccgccgg       360
     ttcaggggcg agctggccgg catcgagggc aacgaggtgc tgatcaacct cgaccagaat       420
     ggcgagacgg tgaccatcgg cctggagttc gactggctga gcgatgccaa gctggttctg       480
     accgacgacc tgatcaagga aatgctgcgc cagcgcaagg ctgccggtgt cctgaacgaa       540
     gatcaattcg acgaaatcgt agaggaagcg cccgaaacgg gcgccacgac catggcccgc       600
     gacgggtccg aagaggagac gaagtaa                                           627
//

If you have problems or comments...

PBIL Back to PBIL home page