(data stored in ACNUC7421 zone)

EMBL: CP000031.PE69

CP000031.PE69        Location/Qualifiers
FT   CDS_pept        complement(71558..72388)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0069"
FT                   /product="hydrolase, carbon-nitrogen family"
FT                   /note="identified by match to protein family HMM PF00795"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0069"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93400"
FT                   /db_xref="GOA:Q5LWM4"
FT                   /db_xref="InterPro:IPR001110"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWM4"
FT                   /protein_id="AAV93400.1"
FT                   /translation="MKTALLQLTSSDDPAANLDMVRGMVAEAAAQGARWVLTPEVTNCV
FT                   SNSTTRQREVLQHEEDDITLAGLRAQATELGIWLLIGSLGLKTHDADGRFANRSFMIGP
FT                   DGGIVARYDKIHMFDVQVTETETFRESANYRPGDRAVLAPTEFGTVGMTICYDLRFPHL
FT                   HAALAQAGATVLTVPAAFSPVTGAAHWESLLRARAIETGCWVLAPAQTGTHPNSRGKPR
FT                   RTHGHSLVVAPWGEVRIDAGSEPGIHIFDLDDTSVTEARRRVPSLTHKRAFDGP"
     atgaaaaccg cgctgctgca actcacctcg tcggacgacc cggcggccaa tctggacatg        60
     gttcggggca tggttgccga ggccgcggca cagggcgccc gctgggtgct gacacccgag       120
     gtgaccaatt gtgtctcgaa cagcaccaca cgccagcgcg aggtgttgca gcacgaagag       180
     gacgacatca ccctggccgg gctcagggcg caggcgaccg agctgggcat ctggctgctg       240
     atcggctcgc tcgggctcaa gacgcatgac gccgatgggc ggtttgccaa ccgctcgttc       300
     atgatcggac cggatggggg gatcgtggcc cgctatgaca agatccacat gttcgacgtg       360
     caggtaaccg agaccgaaac ctttcgcgaa tcggccaatt accggcccgg tgaccgggcc       420
     gtgctggccc cgaccgaatt cggcaccgtg ggcatgacga tctgctacga tctgcgcttt       480
     ccgcatctgc acgcggcgct ggcacaggcg ggggcgaccg tcctgaccgt tccggcagcc       540
     ttttcgccgg tgaccggtgc cgcacattgg gaatcgctgc tcagggcgcg cgcgatcgag       600
     acgggctgct gggtattggc cccggcacag accggcaccc acccaaacag ccgcggcaaa       660
     ccgcgccgca ctcacggtca cagcctggtc gttgcgccct ggggagaggt gcggatcgac       720
     gcaggcagcg aaccggggat tcacatcttc gatctggatg atacatctgt tacagaggcc       780
     cggcgcagag tcccaagctt gactcacaaa cgcgccttcg atggaccctg a                831
//

If you have problems or comments...

PBIL Back to PBIL home page