(data stored in ACNUC7421 zone)

EMBL: CP000031.PE7

CP000031.PE7         Location/Qualifiers
FT   CDS_pept        complement(5683..6297)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0007"
FT                   /product="non-canonical purine NTP pyrophosphatase,
FT                   rdgB/HAM1 family"
FT                   /note="identified by match to protein family HMM PF01725;
FT                   match to protein family HMM TIGR00042"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0007"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93338"
FT                   /db_xref="GOA:Q5LWF7"
FT                   /db_xref="InterPro:IPR002637"
FT                   /db_xref="InterPro:IPR020922"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5LWF7"
FT                   /protein_id="AAV93338.1"
FT                   /translation="MTRAFDGDTLLIATHNKGKLEEMAHLLQPFGVKVVGAAEMNLPEP
FT                   EETEDTFVGNARIKAHAAARATGLPALSDDSGITIDALDGAPGVYTADWAETGNGRDFL
FT                   MAMTRAHDALEAKSAPHPRLAQFRCTLVLAWPDGHDEVFEGVAPGHLVWPIRGAAGFGY
FT                   DPMFVPEGYDVTFAEMDRWEKNKISHRARAVEKFVKGCFGG"
     atgacacggg cgttcgacgg cgacacactg ctgatcgcga cccacaacaa gggcaagctg        60
     gaagagatgg cacatctcct ccagcccttt ggggtcaagg ttgttggcgc cgccgaaatg       120
     aacctgcccg aaccggaaga gaccgaagac acctttgtcg gcaatgcccg gatcaaggcg       180
     cacgccgcgg cccgggccac cggcctgccc gccctgtccg atgacagcgg catcaccatc       240
     gacgcgctgg atggcgcgcc gggcgtctat accgccgact gggccgagac cggcaatggg       300
     cgcgatttcc tgatggcgat gacccgcgcc catgacgcgc tggaagccaa aagcgccccg       360
     catccccggc tggcgcaatt ccgctgcacg ctggttctgg cctggcccga tggccatgac       420
     gaggtgttcg aaggcgtcgc ccccggccat ctggtctggc ccattcgtgg cgccgcaggc       480
     ttcggttatg atccgatgtt cgtgcccgaa gggtatgacg tgacctttgc ggaaatggat       540
     cgctgggaaa agaacaagat cagccaccgc gcacgggcgg tggagaaatt cgtgaagggc       600
     tgttttggcg gatga                                                        615
//

If you have problems or comments...

PBIL Back to PBIL home page