(data stored in ACNUC7421 zone)

EMBL: CP000031.PE71

CP000031.PE71        Location/Qualifiers
FT   CDS_pept        complement(72738..73466)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0071"
FT                   /product="competence protein F, putative"
FT                   /note="identified by similarity to GB:AAK22815.1"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0071"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93402"
FT                   /db_xref="GOA:Q5LWM2"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWM2"
FT                   /protein_id="AAV93402.1"
FT                   /translation="MWQQIQTAIETVYPPRCLGCGDLVTSDFGLCGKCWRDTPFIDGTV
FT                   CDSCGAPLPGARDGHRIECDDCMAHPRPWSDGRAALLYTGRARRMVLALKHGDRPELAR
FT                   PGGLWMARAAAPLLQPNMLIAPVPLHWSRLLRRRYNQSALLAQSVGRQTGLPVCPDLLV
FT                   RDRATPMLEGMSMTERAKTLSGAISVHPKRRHRLTARKLLLIDDVMTSGATLAASAQAC
FT                   LNAGADQVFVLVLARVTREA"
     atgtggcaac agattcaaac cgcgatcgaa acggtctatc cgccgcgctg cctgggttgc        60
     ggcgatctgg taacatccga tttcggcctg tgcggcaaat gctggcgcga cacgcccttt       120
     atcgacggca ccgtctgcga cagttgcggc gcccccctgc ccggcgcccg tgacgggcac       180
     cggattgaat gcgacgactg catggcccat ccgcgcccct ggtcggacgg gcgcgcggcg       240
     ctgctctata ccgggcgggc ccggcgcatg gttctggcgc tgaaacatgg cgaccgaccc       300
     gaactggccc ggcccggcgg gctgtggatg gcccgcgcgg ccgcgcctct gttgcagccc       360
     aacatgctga tcgcgccggt gccgttgcat tggtcccgcc tgttgcgccg ccgctacaac       420
     cagtccgccc tgctggcgca aagcgtcggg cgccagaccg gtctgccggt ctgccccgac       480
     cttctggttc gcgatcgcgc cacaccgatg ctcgaaggga tgagcatgac agagcgggcc       540
     aagaccctga gcggtgcgat ttcggttcat ccaaagcgcc ggcaccggct gaccgcgcgc       600
     aaactgctgc tgatcgacga tgtgatgacc tcgggcgcga ccctggcggc ctcggcgcag       660
     gcctgtctga acgcgggcgc tgatcaagtt ttcgttctgg tactggcgcg ggtcacccgc       720
     gaggcttag                                                               729
//

If you have problems or comments...

PBIL Back to PBIL home page