(data stored in ACNUC7421 zone)

EMBL: CP000031.PE80

CP000031.PE80        Location/Qualifiers
FT   CDS_pept        complement(79294..79785)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0080"
FT                   /product="hypothetical protein"
FT                   /note="identified by match to protein family HMM PF03968"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0080"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93410"
FT                   /db_xref="GOA:Q5LWN1"
FT                   /db_xref="InterPro:IPR005653"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWN1"
FT                   /protein_id="AAV93410.1"
FT                   /translation="MIEIRALILGLVLALGAVAAQAEGTKVAFGAVKADPTLPVEVTAD
FT                   SLDVSQEDGSAEFQGNVLVSQGEMRLSAKRVLVIYNQEASGIERLEATGDVVLVSGSDA
FT                   AQAQRADYTIGTGVIVMTGDVLLTQGKNALSSGKMTVNLTSGTAQMVGRVKTILNSGSD
FT                   "
     gtgatcgaaa ttcgtgcatt gatcctgggc ctcgtccttg cccttggtgc cgttgcggcc        60
     caggccgagg gcaccaaggt tgcattcggc gcggtcaagg ccgacccgac gctgccggtc       120
     gaggtgaccg ccgacagtct ggatgtgagc caggaggacg gctcggccga gttccagggc       180
     aatgtgctgg tctcgcaggg cgagatgcgt ctgtcggcca aacgggtgct ggtgatctac       240
     aatcaggagg cctcggggat cgaacggctg gaggcaaccg gcgacgtggt gctggtcagc       300
     gggtccgacg ccgcccaggc ccagcgcgcc gattacacca tcggcaccgg tgtcatcgtg       360
     atgaccggcg atgtcctgct gacccagggc aagaatgcgc tgagctcggg caagatgacc       420
     gtcaacctga cctcgggcac cgcccagatg gtcgggcggg tgaaaaccat cctcaactcg       480
     ggcagcgact ga                                                           492
//

If you have problems or comments...

PBIL Back to PBIL home page