(data stored in ACNUC9435 zone)

EMBL: CP000031.PE81

CP000031.PE81        Location/Qualifiers
FT   CDS_pept        complement(79789..80397)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0081"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to GB:AAM48708.1"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0081"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93412"
FT                   /db_xref="GOA:Q5LWN0"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWN0"
FT                   /protein_id="AAV93412.1"
FT                   /translation="MAIDSYSRVVQYLKVLLPLTALGLLSAVFLLSSRGTDSVAPIPFA
FT                   EDEIADRTRGQQITGPFFTAVTPKGEQIQVQATLARPGGENAPAEATDLIAELLLLGGK
FT                   RIRLTSDLGTVQLDKDLAIFTGNVVITTSDGLTVTTDQLNAGLSGISGETPGNVRGTGP
FT                   IGEFTAGSMQMGAENEDGPIHIRFKNGVKLLYDPKAAER"
     atggcgatcg acagctactc tcgggttgtc caatacctca aggtgctgtt gccccttacg        60
     gcgcttggcc tgctgtcggc cgtgttcctg ctgtcgtcgc gcggcaccga ttccgtggcc       120
     ccgattccct ttgccgagga tgagatcgcc gaccgcaccc gcggccagca gatcaccggc       180
     ccgttcttta cggcagtcac ccccaagggc gagcagatcc aggtgcaggc gacgctggcc       240
     cgcccgggcg gcgagaacgc acctgccgag gcgaccgacc tgatcgccga actgcttctg       300
     ctcggtggca agcgtatccg gctgacctcg gatctgggca ccgtgcaact ggacaaggat       360
     ctggcgatct tcaccggcaa tgtggtgatc acgacgtcgg acgggctgac ggtgaccacc       420
     gatcagctca acgcagggct gagcggaata tccggcgaaa cccccggcaa cgtgcgcgga       480
     accggaccta tcggagagtt tacagcaggt tctatgcaaa tgggggctga aaacgaggac       540
     ggccctatcc atattcgttt caagaatggc gtgaagctgc tatatgaccc caaagctgcg       600
     gaaagataa                                                               609
//

If you have problems or comments...

PBIL Back to PBIL home page