(data stored in ACNUC7421 zone)

EMBL: CP000031.PE88

CP000031.PE88        Location/Qualifiers
FT   CDS_pept        86668..88158
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0088"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to GB:BAB51963.1"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0088"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93419"
FT                   /db_xref="GOA:Q5LWP1"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR010538"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWP1"
FT                   /protein_id="AAV93419.1"
FT                   /translation="MNIWGPHIVQARRAVAIFCRGLLVLMPALSLLGLTAEAEPRSADD
FT                   RQRIAAVTAPATGFTVAEPFEQLPGGAATVSGDLGRDAFSRPSANMSFERELDFHLGQA
FT                   LFDKLWVASPSSTKASDGLGPLYNARSCQACHIRDGRGQVSGGPGLVLRIGRVRGDGVL
FT                   PDPLFGLQIQDSAVPGLRPEARIAVSQAETEVTLNGGEVAVLRKPRYRLDAAEGTLHAE
FT                   STLSPRLAPQMIGLGLLEAIPEAEILARADPDDRDGDGISGRPNRVHDPETGQEALGRF
FT                   GWKAGAASVLDQTAAAFASDIGISSPLRPAPWGDCTELQVECRAALHGDGDPRGAEIDG
FT                   PALALTAFYSRNLAVPARRDVDDPDVLRGKRVFYGIGCPACHVPKHVTAQLSDQPEQSF
FT                   QLIWPYTDLLLHDMGAGLADELPQGLASGREWRTAPLWGIGLTEQVSGQARFLHDGRAR
FT                   TLLEAVLWHGGEAAAQRDRVIALAPEDRAALIRFLESL"
     atgaatattt gggggcctca tatcgttcag gcgcggcgcg cggtcgcgat cttttgtcga        60
     ggcctccttg tgttgatgcc tgcgctgtca ctccttggcc tcaccgcaga ggccgagccg       120
     cgcagcgcgg atgaccgcca gaggattgcc gccgtcaccg ccccggcaac ggggttcacg       180
     gtggcggaac cctttgaaca gttgcccggt ggcgccgcca cggtatcggg cgatctgggg       240
     cgcgatgcct tctcgcgccc ttcggccaat atgagcttcg agcgggaact ggatttccac       300
     ctgggtcagg ccctgtttga caagctgtgg gtggcgtcac cctcctcgac caaggcatcc       360
     gacgggctgg ggccgctcta caatgcgcgc agctgtcagg cctgccatat ccgcgacggg       420
     cgcggtcagg tttcgggtgg accggggctg gtgctgcgga tcggcagggt ccggggtgac       480
     ggggtgctgc ccgatcccct gttcggactt cagatacagg acagcgccgt gcccggccta       540
     cggcccgagg cacggatcgc ggtgagccaa gccgagaccg aggtcaccct gaacgggggc       600
     gaggtggcgg ttctgcgcaa gccccgatac cggctggacg cggccgaggg cacgctgcac       660
     gccgaaagca cgctcagccc ccggctggca ccacagatga tcgggctggg cctgctcgaa       720
     gcgatccccg aggccgaaat cctggcccgt gccgatccgg acgaccggga tggcgatggc       780
     atatcggggc ggcccaaccg ggtgcacgat ccggagaccg ggcaagaggc gctgggccgg       840
     ttcgggtgga aggctggcgc ggcctcggtc ctggatcaga ccgccgctgc cttcgcctcg       900
     gatatcggca tctcttctcc gctgcgcccc gcgccctggg gcgattgcac cgaattgcag       960
     gtggaatgcc gggctgccct gcatggcgat ggtgatccgc gcggcgccga gatcgacggc      1020
     ccggcgctgg cgctgaccgc gttctacagc cgcaaccttg ccgtgccggc gcggcgggat      1080
     gtggatgacc ccgacgtgtt gcggggcaaa cgggtgttct atggcatcgg ctgcccggcc      1140
     tgtcatgtcc ccaagcatgt gaccgcccag ctgagcgatc agcccgagca gagctttcag      1200
     ctgatctggc cctataccga cctcttgctg catgacatgg gcgcagggct ggccgacgag      1260
     ttgccgcagg gtctggccag cgggcgcgaa tggcgcaccg ctccgctctg ggggattggc      1320
     ctgaccgaac aggtcagcgg gcaggcgcgt ttcctgcacg acgggcgggc gcgcacattg      1380
     cttgaagcgg tgctttggca cgggggcgag gctgcggcgc agcgcgaccg ggtgatcgcc      1440
     cttgcgcccg aggaccgcgc cgccctgatc cggtttctgg agagtctctg a               1491
//

If you have problems or comments...

PBIL Back to PBIL home page