(data stored in ACNUC7421 zone)

EMBL: CP000031.PE89

CP000031.PE89        Location/Qualifiers
FT   CDS_pept        88160..89155
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0089"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to GB:CAE32220.1"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0089"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93420"
FT                   /db_xref="GOA:Q5LWP0"
FT                   /db_xref="InterPro:IPR018976"
FT                   /db_xref="InterPro:IPR034984"
FT                   /db_xref="InterPro:IPR038352"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWP0"
FT                   /protein_id="AAV93420.1"
FT                   /translation="MKQLVALILCLAAAAASADPVDQVLDVHVLPGFARLADETALLAN
FT                   AADAGCEERDPDLRAALNGALRAWAGVSHLRFGPTEAENRAFALAFWPDSRGMTPKALA
FT                   GLIAAEDPVVQEAEGFAQVSVAARGLYALEFLLYDEGQAGNDPYHCALIRAIVRDSAGL
FT                   ARAMAADWHDRYAALMRAPGPDSPYRSRDEAMQELFKALGTGLQITADLRLGRPLGSFA
FT                   RPRPNRAEAWRAGLSLLLVIEALHSQRQLALLLAEEDAGLKARLTDAFDRALGDAAALD
FT                   DPALAGVATPAGRFRVEALQQRVNEIRQVVAQELGPKLGVSAGFNALDGD"
     atgaagcagc ttgttgctct gatcctatgc cttgccgccg cggcagcatc cgccgaccct        60
     gtcgatcagg tgctcgacgt ccatgtgttg ccggggtttg cgcggctggc tgacgagaca       120
     gcgttgctgg ccaacgccgc cgatgccggg tgcgaagagc gcgaccctga cttgcgcgcg       180
     gcgctcaacg gcgcgctgcg cgcctgggcc ggggttagcc atctgcgctt tggtccgacc       240
     gaggcggaaa accgcgcctt tgcgctggcc ttttggcccg acagccgggg catgacgccc       300
     aaggcgctgg cggggctgat cgcggcagag gatccggtgg tgcaggaggc ggagggtttc       360
     gcccaggtct cggtcgcggc gcgcgggctc tatgcgctgg agttcctgct ctatgacgag       420
     ggtcaggcgg gcaacgaccc ctatcactgt gccctgatcc gcgccatcgt gcgcgacagt       480
     gcggggctgg cacgggcaat ggcggcggac tggcatgacc gttacgcggc gctgatgcgc       540
     gcgccggggc cggacagccc ctatcgcagt cgcgacgagg cgatgcagga actgttcaag       600
     gcgctgggca ccggcttgca gatcaccgcc gatctgcgtc tgggccggcc cttgggcagt       660
     tttgccaggc cgcgcccgaa ccgggccgag gcttggcgcg caggtctgtc cctcttgctg       720
     gtcatcgagg cattgcactc gcagcgccag ctggcgctgc tgctggccga agaggatgcc       780
     gggctgaaag cccggcttac cgatgccttt gaccgggcgc tgggggacgc tgcggcgctg       840
     gatgatccgg cattggccgg tgtcgccacc cctgccgggc ggttccgggt cgaggcattg       900
     caacagcgtg tcaacgagat ccggcaggtg gtggcccagg agctggggcc gaaactgggg       960
     gtttcggcgg ggttcaacgc attggacggg gattga                                 996
//

If you have problems or comments...

PBIL Back to PBIL home page