(data stored in ACNUC9435 zone)

EMBL: CP000031.PE92

CP000031.PE92        Location/Qualifiers
FT   CDS_pept        complement(91224..92447)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0092"
FT                   /product="heat shock protein, Hsp70 family"
FT                   /note="identified by similarity to SP:P36928"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0092"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93424"
FT                   /db_xref="GOA:Q5LWN7"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR042054"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWN7"
FT                   /protein_id="AAV93424.1"
FT                   /translation="MARLGVDFGTSNTAAGLVQAGHPRVLPLEPGAQTLPTAVFIDFAA
FT                   RRYVYGTDAARAMMDGQEGRFLRGLKSILGTPLAREPRMFLNERLTLIEVIARFLAEIR
FT                   TRAERLSGERFDRALSGRPVHFHSASAERDAQACTDLHDAYLMAGFSEVCFLPEPEAAA
FT                   LAVAGQGRMLIVDIGGGTSDFTLCDRRGTTTRMLASRGLRIGGTDFDRVLSLDHAMPLL
FT                   GYEAQIGAELGEASHSAPRALFHDLASWEKIAFVYDPATLREVRRWVRLAEQPRLFERL
FT                   AEVLESHLGHDVAYAVEAGKIAANGAAAGRIALDIVERGLGADLGNAAMQAALAGFADE
FT                   IATCAMQTVRDAGVGPDSVDQVVFVGGSSLMGVIRAALARVLPGAEQQDSEVFTAVVHG
FT                   LALASEDQ"
     atggcacgtc ttggcgtgga tttcggaacg tccaacaccg ccgccgggct ggtacaggcg        60
     ggtcatcccc gggttctgcc gctggagccg ggcgcacaga ccctgccgac cgccgtcttc       120
     atcgactttg ccgcgcgccg ctatgtctat ggcaccgacg ccgcccgggc catgatggac       180
     gggcaagagg gccgctttct gcgggggctg aaaagcattc tgggcacccc gctggcccgc       240
     gaaccccgca tgttcctgaa cgagcggctg accctgatcg aggtcatcgc ccgctttctg       300
     gccgagattc ggacgcgcgc cgaacggctg agcggagagc gttttgatcg cgccctgtcg       360
     ggccgtccgg tgcatttcca ctctgcctca gccgagcgcg acgcgcaggc ctgtaccgat       420
     ctgcacgatg cctatctgat ggccgggttc agcgaggtct gctttctacc cgaacccgaa       480
     gctgccgcgt tggcggtggc gggtcagggg cggatgctga tcgtcgacat cggcggcggc       540
     acctcggatt tcaccctgtg cgaccggcgg ggcaccacca cccggatgct ggccagccgg       600
     ggtctgcgca tcggcggcac cgatttcgac cgggtgctga gcctggatca cgccatgccc       660
     ctgctgggat acgaggcgca gatcggggcc gagctgggcg aggccagcca cagcgccccc       720
     cgggctctgt tccacgatct ggccagctgg gaaaagatcg cctttgtcta tgaccctgcc       780
     accctgcgcg aggtacggcg ctgggtgcgg cttgccgaac aaccccgcct gttcgaacgc       840
     ctggccgagg tgttggaatc gcatctgggc catgacgtgg cctatgcggt cgaggcaggc       900
     aagatcgccg caaatggggc cgcagcgggc cgcatcgcgc tggatatcgt cgaacgcggc       960
     ctgggcgccg atctgggaaa tgcggcgatg caggcggcgc tggccggttt cgccgatgag      1020
     atcgccactt gcgccatgca gacggtgcgc gatgccgggg ttggcccgga cagcgtcgat      1080
     caggtggtgt ttgtcggcgg atccagcctg atgggggtga tccgcgccgc gctggcgcgc      1140
     gtcctgccag gcgccgaaca acaggattcc gaagtattca ccgcggtggt tcacggcctc      1200
     gcactggcca gtgaagacca ataa                                             1224
//

If you have problems or comments...

PBIL Back to PBIL home page