(data stored in ACNUC9435 zone)

EMBL: CP000031.PE94

CP000031.PE94        Location/Qualifiers
FT   CDS_pept        93264..95495
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0094"
FT                   /product="sensory box sensor histidine kinase/response
FT                   regulator"
FT                   /EC_number="2.7.3.-"
FT                   /note="identified by match to protein family HMM PF00072;
FT                   match to protein family HMM PF00512; match to protein
FT                   family HMM PF00785; match to protein family HMM PF00989;
FT                   match to protein family HMM PF02518; match to protein
FT                   family HMM TIGR00229"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0094"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93425"
FT                   /db_xref="GOA:Q5LWQ3"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWQ3"
FT                   /protein_id="AAV93425.1"
FT                   /translation="MHVAGSPDVDHLSEYERRYSRRGLLIRYARGRVRNFAGRQIMTFA
FT                   GSFILAMTEGLHTAMLAAFAALLGEVIDCLYLHRLPERLRQGQGYRRLLIGSTLTALVQ
FT                   ALTISFCVWLAWTGARSGLSPLFIGSFLAGAAINAGLVLPFHRPAAVARLAVYAGIGQY
FT                   LFLIEAMEPGRLGDALLLNAAGAVMLAFMVGLFLNFVNWGFRQHRRTTLDLIEQGRDLL
FT                   RHQKEAQLLSLVARNANDSVILADSEGRIVWTNESFTRTTGYSLDEAKGRYPGELLNGD
FT                   KTDLEVSNAIADAVEAGRPFRTEILNVTKDGREIWMETNLVPVLDRNGKVEVTVAIERD
FT                   VTAAKAQAEELAAARVAAEEGARAKAEFLATMSHEIRTPMNGVVGMAELLSETKLSIEQ
FT                   RQYVDTIRSSSTALLAIINDILELSRLDARKMELHPVNFDPVSCVRDTMRLLKPQAQAK
FT                   GLRLSLETGADVPPLVYGDDGRLRQVLINLLGNAIKFTERGGVTLRLRSEAQDPGYLLT
FT                   LEVEDTGIGIAAEKIERVFERFSQADADTTRLYGGTGLGLTISRELVALMGGRITVDST
FT                   LGQGSCFTLCLPLGSPDDDAGQSDGQVLSPAELDRLRGLRVLVADDNRVNRLLMGKFLA
FT                   DLPIRLDFAHDGQQAVAMTQRQKPDIVFMDMSMPVMSGIEATRQIRAAEGRQPLIVALT
FT                   ANTFDSDREACLAAGMDDFLSKPVGRADLFRCLLHHLPPTDAAPRTASG"
     atgcatgttg ccgggtcgcc cgatgtcgac cacctgtctg aatacgaacg aagatacagc        60
     cggcgcggcc tgctgatccg ctacgcacgc gggcgggtca ggaatttcgc cggtcgtcag       120
     atcatgacat tcgccggcag tttcattctt gcgatgactg agggtcttca taccgccatg       180
     ttggcggcct ttgccgcctt gctgggcgag gtgatcgact gcctctacct gcaccggctg       240
     ccagagcgct tgcgccaggg tcagggttac cgccgcctgc tgattggcag taccctcacc       300
     gccttagttc aggcgctgac gatcagcttt tgcgtctggc tggcctggac aggcgcgcgc       360
     agcgggctgt cgccgctgtt catcgggtcg ttcctggcag gggctgcgat caatgccggg       420
     cttgtgcttc cgtttcatcg ccccgccgcc gtggcgcgtc tggcggtcta tgcggggatc       480
     ggccaatacc tgttcctgat cgaggcgatg gagccggggc ggcttggcga cgcgctgttg       540
     ctcaatgccg ccggtgcggt gatgttggcc ttcatggttg gcctgttcct gaatttcgtg       600
     aactggggct ttcgtcagca tcgccggact acgctggatt tgatcgaaca gggacgtgac       660
     ctgctgcgac atcagaagga ggcgcaactg ctgtcgctgg tcgcccgcaa cgccaatgac       720
     agcgtcattc tggcagattc cgaaggccgc atcgtctgga ccaacgagag ttttacccgc       780
     accaccgggt attcgctgga cgaagccaag gggcgctatc ccggcgagtt gctgaatggc       840
     gacaagacag accttgaggt ttcgaatgcg attgccgatg ccgtcgaggc cggccgcccg       900
     tttcgaaccg agatattgaa tgtgaccaag gacggtcgcg agatctggat ggaaaccaat       960
     ctggtgccgg tgcttgaccg gaacggcaag gtcgaagtca ccgttgcgat cgagcgtgac      1020
     gtgacagccg ccaaggcgca ggccgaggaa ctggccgccg cgcgcgtcgc cgccgaggag      1080
     ggcgcgcgcg ccaaggccga gtttctggcc actatgagcc acgagatcag gacgccgatg      1140
     aacggcgtcg tgggtatggc cgagctgttg tcggaaacca agctttcgat cgagcagcgg      1200
     caatatgtcg ataccatccg aagctcttcg accgccttgc tggcgatcat taacgacatt      1260
     ctggaactgt cgcgcctgga tgcccggaag atggaattgc atccggtgaa tttcgatccg      1320
     gtgtcctgtg tcagggacac catgcgcctg ctgaaaccgc aggcgcaggc caaggggctg      1380
     aggctgtctc ttgaaacagg ggccgatgtt ccccccctcg tgtatggtga cgatgggcga      1440
     ttgcgccagg ttctgatcaa tctgcttggc aacgcgatca agttcaccga acgcggcggt      1500
     gtgaccctgc gtttgcggtc cgaggcgcag gacccgggat atctgttgac gctcgaggtc      1560
     gaggataccg gcatcggcat cgccgccgaa aagatcgaga gggtgttcga gcggttctcg      1620
     caggcggatg ccgacaccac gcgtctttac ggcgggaccg gccttgggct gacgatctcg      1680
     cgcgagctgg ttgcgctgat gggcggtcgg atcaccgttg actcgacgct tgggcagggg      1740
     tcgtgtttta cgctgtgcct gccgttgggg tcgcccgatg acgacgccgg acaatcagat      1800
     gggcaggtgc tgtcaccggc tgagcttgac cggttgcgcg gcctgcgtgt gctggttgcc      1860
     gatgacaacc gtgtcaaccg tttgctcatg ggcaagttcc tggccgatct gccgatccgc      1920
     ctggactttg cccatgatgg tcagcaggcg gttgccatga cgcagcggca aaagcctgac      1980
     atcgtgttca tggacatgtc gatgccggtg atgagcggca tcgaggcgac ccggcagatc      2040
     cgtgccgcag agggcaggca gcccttgatc gtggcgctga ccgcaaatac gttcgacagc      2100
     gaccgcgaag cctgtcttgc cgccgggatg gacgatttcc tcagcaaacc ggtgggccgg      2160
     gcagatctgt tccggtgcct gctgcaccat ttgccaccca ccgacgcggc accaagaacc      2220
     gcatccggct ga                                                          2232
//

If you have problems or comments...

PBIL Back to PBIL home page