(data stored in ACNUC7421 zone)

EMBL: CP000031.PE96

CP000031.PE96        Location/Qualifiers
FT   CDS_pept        complement(96926..97840)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0096"
FT                   /product="membrane protein, putative"
FT                   /note="identified by match to protein family HMM PF00892"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0096"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93427"
FT                   /db_xref="GOA:Q5LWQ1"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWQ1"
FT                   /protein_id="AAV93427.1"
FT                   /translation="MNARSGDNVVLAILLSLLALVLFDMMGLIIKYLSPRYGAAELSAY
FT                   RNFFGVFPSVIALWSSPGWHRAGRPWRIRQWRLGLMRGVYVTFAQFLFYYSLGKLAFAT
FT                   ASTITYANAVFMTALAVPLLGERVGLMRWAAVLLGFAGVLLVMKPGSDSFTPDALAPLG
FT                   AAFLYALTGVSARQMDSAVPSALINLYSVVAALVGALALALLSGGFTPLAQWSDLGWIA
FT                   AMGGFGGTAVLCLVASYRMTEQSNLAPFSYFGIPIAFVAGWLVFDETPWADLFPGAFFI
FT                   AGGGLMIVWRERIRSRAGRRISN"
     atgaacgcgc gcagcggaga taacgtggtt cttgccatcc ttttgtcgct gctggcgctg        60
     gtcctgttcg acatgatggg gctgatcatc aaatacctgt cgccgcgcta tggtgcggca       120
     gagctgtcgg cctatcgcaa cttcttcggc gtctttccca gcgtgatcgc actgtggtcc       180
     tcgcccgggt ggcatcgggc ggggcggccc tggcgcatcc ggcagtggcg gctggggctg       240
     atgcgcgggg tctatgtgac ctttgcccag ttcctgttct actattcgct gggcaagctg       300
     gcctttgcca ccgcctcgac catcacctat gccaatgcgg tgttcatgac cgcacttgcg       360
     gtacctctgc tgggcgagcg ggtggggctg atgcgctggg cggcggtgct gctcgggttt       420
     gccggggtgc ttctggtgat gaagccgggc agtgacagtt tcacgccgga tgcgctggcg       480
     ccgctggggg ccgcattcct ctatgcgctg accggggtgt cggcgcggca gatggacagc       540
     gcggtgccaa gcgcgctgat caacctctat tcggttgtgg ccgcgctggt cggggcattg       600
     gcgctggcat tgctgagcgg tgggttcact ccgcttgctc aatggtccga cctgggatgg       660
     attgcggcaa tgggagggtt cggagggaca gcggtgctgt gtctggtggc ctcgtaccgg       720
     atgaccgagc agagcaatct ggcccccttc agctatttcg gcattcccat cgcctttgtc       780
     gcgggctggc tggtgtttga cgaaacgccc tgggccgacc tgtttcctgg ggcgttcttc       840
     atcgcgggtg gtgggctcat gatcgtttgg cgcgaaagga tcagatcgcg ggcggggcgc       900
     cgaatttcaa actga                                                        915
//

If you have problems or comments...

PBIL Back to PBIL home page