(data stored in ACNUC9435 zone)

EMBL: CP000031.PE97

CP000031.PE97        Location/Qualifiers
FT   CDS_pept        complement(97843..99294)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0097"
FT                   /product="aldehyde dehydrogenase family protein"
FT                   /note="identified by match to protein family HMM PF00171"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0097"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93428"
FT                   /db_xref="GOA:Q5LWQ0"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWQ0"
FT                   /protein_id="AAV93428.1"
FT                   /translation="MTLPLWFDPTLCLIGGRWQAPRGGDTLPLINPSDGTEICRIARGT
FT                   APDIDTAVTAAEAALAGDWGRMTATERGRILSRLGQLVLERVEDLAVIEAWDVGKPLTQ
FT                   ARADAVALARYCEFYGGAADKVMGETIPYLEGYTVYTLREPHGVTGHIVPWNYPMQIIG
FT                   RSVGAALAMGNACVLKPAEEACLTALAFADLAKQAGLPAGALNVVPGLGAEAGAALSAH
FT                   PGVHHISFTGSVATGALVQQAAGRNVVPVTLELGGKSPQLVFDDADLDTALPFLVNAGC
FT                   QNAGQTCSASSRILAQRGVYEEVKARMAASYAELTVGPAMEDLRVGPLISARQKEIVTG
FT                   FLDKGADLTIAAQGRIVDHAPETGAYVRPTLFADVPPDHALARDEIFGPVQVLIPFDTE
FT                   EEAIAIANGTDYGLVASIWTRDGARQMRLAKRLRAGQVFVNNYGAGGGVELPFGGVGKS
FT                   GHGREKGFEALYGFSQLKTVAARHG"
     atgaccctac ccctctggtt cgatcccacc ctctgcctga tcggaggccg ctggcaggcc        60
     ccccggggtg gcgataccct gccgctgatc aacccgtccg acgggaccga aatctgccgc       120
     atcgcccgtg gcaccgcacc cgatattgac acggcggtga cagccgccga ggccgcgctg       180
     gccggtgact ggggccggat gaccgcgacc gagcggggcc gcatcctgtc ccgtttgggc       240
     cagttggtgc tggagcgggt cgaggatctg gcagtgatcg aggcctggga tgtcggcaaa       300
     ccgctgaccc aggcccgcgc cgatgcggtg gcactggcgc ggtattgcga attctacggc       360
     ggtgccgccg acaaggtgat gggcgagacc attccctatc tcgagggcta taccgtctat       420
     accctgcgcg aaccgcacgg ggtcacggga catatcgtgc cctggaacta tccgatgcag       480
     atcatcggcc gttcggtcgg cgcggcgctg gccatgggca atgcctgcgt tctgaaaccg       540
     gccgaagagg cctgtctgac cgcgctggcc tttgccgatc tggcgaaaca ggcggggctg       600
     cccgcaggtg cactgaacgt ggtgccgggg ctgggggccg aggcgggcgc ggcactgtcc       660
     gctcatcccg gcgtgcacca tatctcgttc accggatcgg tcgccactgg cgcgctggtg       720
     cagcaggcgg cggggcgcaa tgtggtgccg gtcacgctgg aactgggggg caagtcgccg       780
     cagctggtgt tcgacgatgc cgatctggat accgcgctgc cgttcctggt gaatgcgggg       840
     tgccagaatg ccggtcagac ctgctcggcc tcttcccgca ttttggccca gcgcggggtc       900
     tatgaagagg tcaaggctcg catggccgca tcctatgccg aactgacggt tggccccgcg       960
     atggaggatc tgcgggtggg gccgttgatc tcggcccggc aaaaggagat cgtgaccggg      1020
     tttctggaca agggcgccga cctgaccatc gcggcacagg gccggatcgt ggaccacgcc      1080
     cccgaaaccg gggcctatgt gcgaccgacg ctgttcgccg atgtgccccc cgatcatgcg      1140
     ctggcccgag acgagatttt cggccctgta caggtcctga tcccctttga caccgaggaa      1200
     gaggcgatcg ccatcgccaa tggcaccgat tacggtctgg tcgccagcat ctggacccgc      1260
     gacggcgcgc gccagatgcg tctggccaag cggttgcggg ccggacaggt cttcgtcaac      1320
     aattacggtg ccggcggcgg ggtcgaactg ccctttggcg gggtcggcaa atccggccac      1380
     ggacgcgaga aaggcttcga agcgctctac ggtttctcgc agctcaagac cgtcgccgcg      1440
     cggcacggct ga                                                          1452
//

If you have problems or comments...

PBIL Back to PBIL home page