(data stored in ACNUC9435 zone)

EMBL: CP000031.PE98

CP000031.PE98        Location/Qualifiers
FT   CDS_pept        complement(99759..101357)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0098"
FT                   /product="peptide/opine/nickel uptake family ABC
FT                   transporter, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0098"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93429"
FT                   /db_xref="GOA:Q5LWP9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWP9"
FT                   /protein_id="AAV93429.1"
FT                   /translation="MSLLQITDLSLSIHAYDILKRVSLTIDAGEIVAVTGESGSGKSMT
FT                   ALAVMQLLPGGARASGSIRLDGQEILTLPEAEMCALRGAAVGMVFQEPMTALNPVKTIG
FT                   DQVMETILIHKAMTPIRAEERAREVLTRVGLPPDRFPLSRYPHELSGGQRQRVVIAMAI
FT                   ALRPKLLIADEPTTALDVTTQAQILDLLKGLVQEYGMGMLMITHDLAVVADMADHITVM
FT                   RHGEVVEAAPTQRLLTGMSHPYTKMLFAASDHRVTLPAPPPPAPLLEVSEVVRDYALPR
FT                   TRLFAHPGHHRAVDHVSFALNRGERLGLVGESGCGKSTLTRAILGLEPVQGGEIRLAGQ
FT                   PVYDGKRANPEIRRRMQVVFQDPYGSFNPRHRVDRLVTEPFHLLDAPPTGSDRSDRIAE
FT                   MLTAVGLSPDDAGKYIHEFSGGQRQRIAIARALIIRPQLILFDEAVSALDVSVRAQILD
FT                   LLAQLCSEYDLTYLFISHDLSVVRTITDRVLVMQSGRIVEQGETAQVFSDPAHPYTRAL
FT                   IAAAPRLPETGARRA"
     atgagcctgt tgcagatcac cgacctgtcg ctgtcgatcc atgcctatga catcctcaag        60
     cgcgtctcac tgaccatcga cgcgggcgag atcgtggccg tcaccggcga gagcggctcg       120
     ggcaagtcga tgacggcgct ggccgtgatg cagctgttgc ccggcggagc gcgagccagc       180
     ggctcgatcc ggctggacgg acaagagatt ctgaccctgc ccgaggcaga aatgtgcgcc       240
     ctgcgcggcg cggcggtcgg gatggtgttt caggaaccga tgaccgcact gaacccggtc       300
     aagaccatcg gcgatcaggt gatggaaacg atcctgatcc acaaagcgat gacgcccatc       360
     agggcggaag agcgcgcgcg cgaagtgctg acccgtgtcg gcctgccgcc tgaccggttc       420
     ccgctttcgc gctatccgca tgaactcagc ggcggccagc gccagcgcgt ggtcatcgcc       480
     atggccatcg cactgcgccc gaaactgctg atcgcggacg agccgacaac cgcgctcgac       540
     gtcaccacgc aggcgcagat cctcgacctg ctcaaggggc tggtgcagga atacggcatg       600
     ggcatgctga tgatcaccca tgacctggcc gttgttgccg acatggccga ccatatcacc       660
     gtcatgcgcc atggcgaggt ggtcgaggcc gccccgaccc agcgcctgct gaccggtatg       720
     agtcatccct atacgaagat gctgttcgcc gcctcggatc accgcgtgac cctgcccgcg       780
     ccaccgccac cggcaccgct gctggaggtg tcggaggtgg tgcgcgacta tgccctgccg       840
     cgcacccggc tgtttgcgca cccggggcat caccgcgccg tggatcatgt cagctttgcc       900
     ctgaaccggg gcgagcggct ggggctggtc ggcgaatccg gctgtggcaa atccaccctg       960
     acacgcgcca tcctggggct ggagccggta cagggcggcg aaatccgtct ggcggggcaa      1020
     ccggtctatg acggcaaacg cgccaatccc gaaatccgcc gccgcatgca ggtggtgttt      1080
     caggatcctt acggcagctt caacccgcgc caccgtgtcg accggctggt gaccgaaccg      1140
     tttcatctgc tcgatgcgcc gccaaccggg tcggaccgca gcgaccgcat tgccgagatg      1200
     ctgaccgccg tcggcctgtc gcccgacgat gcgggaaagt atatccacga gttttccggc      1260
     ggtcagcgcc agcgcatcgc cattgcccgt gcgctgatca tccggcctca gctgatcctg      1320
     ttcgacgagg cggtctcggc gcttgatgtc tcggtccggg cgcagatcct tgacctgctg      1380
     gcgcagctct gctccgaata tgacctgacc tatctgttca tcagccatga tctgagcgtg      1440
     gtgcgcacga tcaccgaccg ggtgctggtg atgcaatcgg gccgcattgt cgaacagggc      1500
     gagaccgcac aggtcttctc ggaccccgcg catccctata cccgggccct gatcgccgcc      1560
     gcgccgcgtc tgcccgaaac cggggcgcgg cgggcatga                             1599
//

If you have problems or comments...

PBIL Back to PBIL home page