(data stored in ACNUC9435 zone)

EMBL: CP000031.PE99

CP000031.PE99        Location/Qualifiers
FT   CDS_pept        complement(101354..102169)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0099"
FT                   /product="peptide/opine/nickel uptake family ABC
FT                   transporter, permease protein"
FT                   /note="identified by match to protein family HMM PF00528"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0099"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93430"
FT                   /db_xref="GOA:Q5LWP8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWP8"
FT                   /protein_id="AAV93430.1"
FT                   /translation="MSRNLILGAGLSSLVVLAALISFIWTPYDHAALNIPAKLQTPNAR
FT                   HWFGTDHFGRDMFSMIMVGARTSIAVALLAVGIGMSLGVPLGLAAAARKGSWLDELIMR
FT                   GNDLVFAFPSLVIAILITAVFGAGAVNAIIAIGIFNIPVFARITRGAALSLWEREFILA
FT                   ARVAGKGAARISAEHILPNVANLLIVQGTIQFSLGILAEAGLSYVGLGAQPPTPSWGRM
FT                   LADAQTMVSFAPHLALIPGLAIILTVLGLNLMGDGLRDWLDPRLRVART"
     atgagccgca acctgatcct gggcgcgggc ctgtcctcgc tggtggtgct ggccgcgctc        60
     atctctttca tctggactcc ctacgaccat gccgcgctga acatcccggc caagctgcaa       120
     accccgaatg cgcggcactg gttcggcacc gaccatttcg ggcgcgacat gttttccatg       180
     atcatggtcg gcgcgcgcac ctcgatcgcg gtggccctgc tggcggtggg tatcggcatg       240
     agcctgggcg tgccgctggg cttggcggcc gcggcgcgca agggatcgtg gctggacgag       300
     ttgatcatgc gcggcaacga tctggtcttt gcgttcccct cgctggtgat cgccatcctg       360
     atcaccgccg tctttggcgc tggcgccgtc aacgccatca tcgccatcgg catcttcaac       420
     atcccggtct ttgcccgcat cacccgtggc gccgcgctca gcctgtggga gcgcgaattc       480
     atcctggcgg cgcgcgtcgc gggcaagggg gcagcgcgca tctcggccga acatatcctg       540
     ccaaacgtgg cgaacctgct aatcgtgcag ggcaccatcc agttctcgct gggcatcctg       600
     gccgaggcgg ggctgagtta tgtcggcctt ggcgcgcagc cgccgacgcc cagctggggc       660
     cggatgctgg cggacgcgca gaccatggtc agtttcgccc cccatctggc gctgatcccc       720
     ggactggcga tcatcctgac ggtgctgggt ctgaacctga tgggcgacgg gctgcgcgac       780
     tggctcgatc cccggctcag ggtggcgcgc acatga                                 816
//

If you have problems or comments...

PBIL Back to PBIL home page