(data stored in ACNUC7421 zone)

EMBL: CP000031.PETA

CP000031.PETA        Location/Qualifiers
FT   CDS_pept        288197..288760
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="petA"
FT                   /locus_tag="SPO0271"
FT                   /product="ubiquinol-cytochrome c reductase, iron-sulfur
FT                   subunit"
FT                   /EC_number="1.10.2.2"
FT                   /note="identified by match to protein family HMM PF00355;
FT                   match to protein family HMM TIGR01409; match to protein
FT                   family HMM TIGR01416"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0271"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93591"
FT                   /db_xref="GOA:Q5LX56"
FT                   /db_xref="InterPro:IPR005805"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR006317"
FT                   /db_xref="InterPro:IPR014349"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR019470"
FT                   /db_xref="InterPro:IPR019546"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LX56"
FT                   /protein_id="AAV93591.1"
FT                   /translation="MSHAEDHEGTRRDFLYYATAGAGVVTTGAAVWPLVNQMNPSADVQ
FT                   ALSSIRVDISGVEVGTQISVKFLGKPVFIRRRTQAEIDEARAVDLSDLIDNDSRNPNLS
FT                   GGGDGGDENRSLDENGEWLVMMGVCTHLGCVPLGDGAGDFHGWFCPCHGSHYDTSGRIR
FT                   KGPAPENLHIPVAEFVDENTIKLG"
     gtgtcccacg cagaagatca cgaaggcacc cgcagagatt tcctctacta cgccacggct        60
     ggcgcaggtg tcgtaaccac cggggccgct gtctggccgc tggtcaacca gatgaacccg       120
     tcggcggatg ttcaggcgct gtcgtcgatt cgcgttgaca tcagcggtgt cgaggtcggc       180
     acccagatca gcgtcaagtt cctgggcaag ccggtgttca tccgccgccg cacccaggcc       240
     gagatcgacg aagcccgcgc ggtcgatctg tccgatctga tcgacaacga ctcccgcaac       300
     cccaacctga gtggtggcgg tgatggcggt gacgaaaacc gctcgctgga cgaaaacggc       360
     gaatggctgg tgatgatggg tgtctgcacc catctgggct gtgtgccgct gggcgacggc       420
     gccggcgact tccacggctg gttctgcccc tgccacggct cgcactacga tacctctggc       480
     cggatccgca aaggtcccgc gcccgagaac ctgcacattc cggttgcaga gttcgtcgac       540
     gaaaacacca tcaagctggg ataa                                              564
//

If you have problems or comments...

PBIL Back to PBIL home page