(data stored in ACNUC9435 zone)

EMBL: CP000031.PETB

CP000031.PETB        Location/Qualifiers
FT   CDS_pept        288773..290101
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="petB"
FT                   /locus_tag="SPO0272"
FT                   /product="ubiquinol--cytochrome c reductase, cytochrome B"
FT                   /EC_number="1.10.2.2"
FT                   /note="identified by similarity to SP:P05418; match to
FT                   protein family HMM PF00032; match to protein family HMM
FT                   PF00033"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0272"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93592"
FT                   /db_xref="GOA:Q5LX55"
FT                   /db_xref="InterPro:IPR005797"
FT                   /db_xref="InterPro:IPR005798"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="InterPro:IPR027387"
FT                   /db_xref="InterPro:IPR030689"
FT                   /db_xref="InterPro:IPR036150"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LX55"
FT                   /protein_id="AAV93592.1"
FT                   /translation="MAGIPHDHYEPKTGAEKWLNSRLPIVGLIYDTIMIPTPKNLNWWW
FT                   IWGIVLAFCLALQIVTGIVLVMHYTPHVDMAFASVEHIMRNVNGGYMLRYLHANGASLF
FT                   FVAVYIHIFRGLFYGSYKAPREITWIVGMLIYLCMMGTAFMGYVLPWGQMSFWGATVIT
FT                   GLFGAIPFVGEAIQTWLLGGPAVDNATLNRFFSLHYLLPFVIAALVIVHIWAFHTTGNN
FT                   NPTGVEVRRGSKAEAEKDTLPFWPYFVIKDLVGLAIVLVIFWAIVGFMPNYLGHPDNYI
FT                   EANALVTPAHIVPEWYFLPFYAILRAFTSEVWVVQIASFVTGGIIDAKFFGVLAMFGAI
FT                   LAMALAPWLDTSSVRSGKYRPMFKWWFYLLIIDFFALMWLGAMPAEEPYASFSLIASAY
FT                   WFGYFFVILPILGVIEKPLPQPATIEEDFNAHYGTASDATPAE"
     atggccggta ttccgcacga ccattacgaa ccgaagacgg gcgcagagaa gtggctgaac        60
     agccgcttgc ccatcgtcgg cctgatctat gacaccatca tgatccccac ccccaagaac       120
     ctgaactggt ggtggatctg gggcatcgtc ctggccttct gcctggcgct gcaaatcgtc       180
     accggcatcg tgctggtgat gcattacacg ccgcatgtcg acatggcctt tgccagcgtc       240
     gagcatatca tgcgcaacgt gaacggcggc tatatgctgc ggtatctgca tgcaaacggc       300
     gcctcgctgt tctttgtcgc cgtctatatc cacatcttcc gcggcctgtt ctacggctcg       360
     tacaaggccc cgcgcgagat cacctggatc gtcggcatgc tgatctatct ctgcatgatg       420
     ggcaccgcct tcatgggcta tgtgctgccg tggggacaga tgtcgttctg gggcgcaacc       480
     gtgatcactg gcctgtttgg cgccatcccc tttgtgggcg aggcgatcca gacctggctg       540
     ctgggcgggc ccgccgtgga caatgccacg ctgaaccgct tcttctcgct gcactatctg       600
     ctgcccttcg tcatcgcggc gctggtcatc gtgcatatct gggccttcca caccaccggc       660
     aacaacaacc ccacgggtgt tgaggtgcgt cgcggatcga aggccgaggc cgagaaggac       720
     acgctgccgt tctggcccta tttcgtgatc aaggacctgg tggggctggc catcgtgctg       780
     gtgatcttct gggcgatcgt cggcttcatg ccgaactatc tgggccatcc cgacaactat       840
     atcgaggcca acgcgctggt gacgcccgcg catatcgtgc ccgaatggta cttcctgccg       900
     ttctacgcca tcctgcgtgc cttcacctcc gaagtctggg tggtgcagat cgccagcttt       960
     gtgaccggcg gcatcatcga cgccaagttc tttggcgtgc tggcgatgtt cggcgcgatc      1020
     ctggccatgg cgctggcgcc ctggctcgac acctcgtcgg tgcgttcggg caagtaccgt      1080
     ccgatgttca aatggtggtt ttacctgctg atcatcgact tcttcgccct gatgtggctg      1140
     ggcgcgatgc cagcggaaga accctatgca tccttctcgc taatcgcttc ggcctattgg      1200
     ttcggctact tcttcgtgat cctgcccatc ctgggcgtga tcgagaagcc gctgccgcag      1260
     ccggccacga tcgaggaaga cttcaacgcg cactacggca cggcgtctga cgccactccg      1320
     gccgagtaa                                                              1329
//

If you have problems or comments...

PBIL Back to PBIL home page