(data stored in ACNUC7421 zone)

EMBL: CP000031.PETP

CP000031.PETP        Location/Qualifiers
FT   CDS_pept        complement(272374..272886)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="petP"
FT                   /locus_tag="SPO0252"
FT                   /product="transcriptional regulator PetP"
FT                   /note="identified by similarity to SP:P31078; match to
FT                   protein family HMM PF01047"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0252"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93572"
FT                   /db_xref="GOA:Q5LX37"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR023187"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LX37"
FT                   /protein_id="AAV93572.1"
FT                   /translation="MSEARPSPVFGGESLLFLTDEQLRQGIEAMFFAYRGFTADPDRIL
FT                   AEMAYGRAHHRAIHFINRAPGTTVNNLLAILGVTKQSLNRVLRTLIADGLVESRVGTQD
FT                   KRERHLFLTEAGAALEAKLSDAQRARMRAAYKEAGPEAVTGFRQVLEAMMDREMHRAYA
FT                   KLRDSGS"
     atgtccgagg cacgaccgtc accggtcttt gggggtgaaa gcctgctgtt tctgaccgac        60
     gagcagctgc ggcaggggat cgaggcgatg ttctttgcct atcgcggctt caccgccgat       120
     cccgaccgga tcctggccga gatggcctat ggccgcgccc atcaccgcgc gatccacttc       180
     atcaaccgtg cgccgggcac cacggtgaac aacctgctgg ccattctggg cgtcaccaag       240
     cagtcgctga accgggtgct gcgcaccctg atcgccgacg ggttggtcga aagccgggtc       300
     ggcacccagg acaagcgcga gcggcatctg ttcctgaccg aggcgggtgc tgcgcttgag       360
     gcgaaactgt ccgacgcgca gcgcgcccga atgcgcgccg cctataagga ggccgggccc       420
     gaggcggtaa ccggctttcg ccaggtgcta gaggcgatga tggaccgcga gatgcaccgg       480
     gcctatgcca agctgcggga cagcggctca tga                                    513
//

If you have problems or comments...

PBIL Back to PBIL home page