(data stored in ACNUC7421 zone)

EMBL: CP000031.PHBA

CP000031.PHBA        Location/Qualifiers
FT   CDS_pept        complement(336736..337911)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phbA"
FT                   /locus_tag="SPO0326"
FT                   /product="acetyl-CoA acetyltransferase"
FT                   /EC_number="2.3.1.9"
FT                   /note="identified by similarity to SP:P54810; match to
FT                   protein family HMM PF00108; match to protein family HMM
FT                   PF02803; match to protein family HMM TIGR01930"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0326"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93644"
FT                   /db_xref="GOA:Q5LXA8"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020610"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020615"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LXA8"
FT                   /protein_id="AAV93644.1"
FT                   /translation="MTNVVIASAARTGVGSFGGSFANTPAHDLGAAVLEAVVERAGIDK
FT                   AEVSETILGQVLTAAQGQNPARQAHVNAGLPKESSAWGINQVCGSGLRAVALGAQHILL
FT                   GDAEIVAAGGQENMTLSPHAAALRAGHKMGDMKYIDTMIRDGLWDAFNGYHMGQTAENV
FT                   AEQWQISREMQDEFAVASQNKAEAAQNAGKFADEIVPFIIKTRKGDIVMDKDEYIRHGA
FT                   TIEAMQKLRPAFTKDGSVTAANASGLNDGAAATLLMTAENAEKRGIEPLARIASYATAG
FT                   LDPSIMGVGPIHASRKALAKAGWKVEDLDLVEANEAFAAQACAVNKDMGWDPAIVNVNG
FT                   GAIAIGHPIGASGCRVLNTLLFEMKRRNAKKGLATLCIGGGMGVALCVERD"
     atgaccaacg tagtaattgc atctgccgcc cgcaccggcg tcggcagctt tggcggctct        60
     ttcgcgaata ccccggcgca tgacctgggc gcagcggtgc tcgaagccgt tgtcgagcgc       120
     gccggcatcg acaaggccga ggtaagcgag accatcctgg gccaggtcct gaccgccgcc       180
     cagggtcaga acccggcccg ccaggcccat gtcaatgcag gcctgcccaa ggaaagctcg       240
     gcctggggta tcaaccaggt ctgcggttcg ggcctgcgcg ccgtggcact gggtgcacaa       300
     catatcctgc tgggcgatgc cgagatcgtc gccgccggtg gtcaggaaaa catgaccctg       360
     tcgccccatg ccgccgcgct gcgcgccggt cacaagatgg gcgacatgaa atacatcgac       420
     accatgatcc gcgacgggct gtgggatgcg ttcaacggct atcacatggg ccagaccgcc       480
     gagaacgtgg ccgagcagtg gcagatcagc cgcgagatgc aggacgagtt cgccgtcgcc       540
     agccagaaca aggccgaggc tgcgcagaat gccggcaagt tcgccgatga aatcgtcccc       600
     ttcatcatca agacccgcaa gggcgatatc gtgatggaca aggacgaata catccgccac       660
     ggcgccacca tcgaggcgat gcagaaactg cgccccgcct tcaccaagga cggcagcgtc       720
     accgccgcca atgcaagcgg cctgaatgac ggcgccgccg caaccctgct gatgaccgcc       780
     gagaacgccg aaaagcgcgg gatcgaaccg ctggcccgca tcgcctctta cgccaccgcg       840
     gggctcgacc cgtcgatcat gggtgtcggc ccgatccacg ccagccgcaa ggcgctggcc       900
     aaggccggct ggaaggtcga agacctggat ctggtcgagg caaacgaggc ctttgccgcc       960
     caggcctgcg cggtgaacaa ggacatgggc tgggatccgg ccatcgtcaa cgtgaacggc      1020
     ggcgccatcg ccatcggtca cccgatcggc gcctcgggct gccgggttct gaacaccctg      1080
     ctgttcgaaa tgaagcgccg caacgccaag aaaggtctgg cgaccctctg catcggcggc      1140
     ggcatgggtg tcgccctttg cgtggagcgc gactga                                1176
//

If you have problems or comments...

PBIL Back to PBIL home page