(data stored in ACNUC7421 zone)

EMBL: CP000031.PHBB

CP000031.PHBB        Location/Qualifiers
FT   CDS_pept        complement(335827..336549)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phbB"
FT                   /locus_tag="SPO0325"
FT                   /product="acetoacetyl-CoA reductase"
FT                   /EC_number="1.1.1.36"
FT                   /note="identified by similarity to SP:P23238; match to
FT                   protein family HMM PF00106; match to protein family HMM
FT                   TIGR01829"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0325"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93643"
FT                   /db_xref="GOA:Q5LXA9"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR011283"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LXA9"
FT                   /protein_id="AAV93643.1"
FT                   /translation="MARTALVTGGSRGIGAAISKALKAEGYNVAATYAGNDEAATAFTA
FT                   ETGIATYKWNVADYDESAAGIAKVEAEVGPIDIVVANAGITRDAPFHKMTPEQWHQVID
FT                   TNLTGVFNTVHPVWPGMRERKFGRVIVISSINGQKGQFAQVNYAATKAGDLGIVKSLAQ
FT                   EGARAGITANAICPGYIATEMVMAIPEKVRDSIVAGIPAGRLGEPEEIARCVTFLASED
FT                   SGFINGSTISANGAQFFV"
     atggcacgaa cagcactcgt caccggcggc tcgcgcggta tcggcgcagc aatttccaag        60
     gcgcttaagg ccgagggcta caatgtcgct gccacctatg ccggcaatga cgaagccgcg       120
     accgccttta ctgccgagac cggcatcgct acctacaagt ggaacgtcgc cgactatgat       180
     gaatcggccg ccggtatcgc caaggtcgag gccgaagttg gcccgatcga catcgtggtc       240
     gccaatgccg gtatcacccg cgatgcgccg ttccacaaga tgacccccga acagtggcat       300
     caggtgatcg acaccaacct gaccggcgtg ttcaacaccg tgcacccggt ctggcccggc       360
     atgcgcgagc gcaagttcgg ccgcgtcatc gtgatcagct cgatcaacgg ccagaagggc       420
     cagttcgcgc aggtgaacta tgccgcgacc aaggcgggcg atctgggcat cgtcaagtcg       480
     cttgcccagg aaggcgcccg cgccggcatc accgcaaacg ccatctgccc cggctacatc       540
     gccaccgaga tggtgatggc gatccccgaa aaggtgcgtg attcgatcgt ggcaggcatc       600
     cccgccgggc gccttggcga acccgaggaa atcgcccgct gcgtgacctt cctggcgtct       660
     gaggactcgg gcttcatcaa cggctcgacc atttcggcca acggcgcgca gttcttcgtc       720
     tga                                                                     723
//

If you have problems or comments...

PBIL Back to PBIL home page