(data stored in ACNUC7421 zone)

EMBL: CP000031.PHNG

CP000031.PHNG        Location/Qualifiers
FT   CDS_pept        475557..476012
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phnG"
FT                   /locus_tag="SPO0468"
FT                   /product="alkylphosphonate utilization protein PhnG"
FT                   /note="identified by similarity to SP:P16685"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0468"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93786"
FT                   /db_xref="GOA:Q5LW74"
FT                   /db_xref="InterPro:IPR009609"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LW74"
FT                   /protein_id="AAV93786.1"
FT                   /translation="MAEQEKETAARQGWMGLLARAPEAMLMALWNRVEERPAFDWLRAP
FT                   ETGGVMVRGRAGGTGAPFNLGEMTVTRCALALADGTVGHAYVQGRSRAKAEAAALIDAL
FT                   MQTAAADTIRALVLDPLAAQMAERSEGRAARAAATKVEFFTLVRGED"
     atggcagaac aagagaaaga gacggcggcg cggcagggct ggatgggcct tttggcgcgt        60
     gcgcccgagg cgatgctgat ggcactgtgg aaccgggtcg aggagcgccc cgcgttcgac       120
     tggctgcgcg cgcccgaaac cggtggcgtg atggtgcgcg gccgcgccgg cggcaccggc       180
     gcccccttca acctgggtga gatgacggtg acccgctgcg ccttggcgct ggctgatggc       240
     acggtggggc atgcctatgt ccagggtcgc tcgcgtgcca aggccgaggc ggcggcgctg       300
     atcgacgcgc tgatgcagac cgccgccgcc gacaccatcc gcgccttggt tctggacccg       360
     ctggcggcgc agatggccga gcgctcagag ggccgcgccg cgcgcgcagc cgccaccaag       420
     gtcgagtttt tcacgctggt cagaggagag gattga                                 456
//

If you have problems or comments...

PBIL Back to PBIL home page