(data stored in ACNUC9435 zone)

EMBL: CP000031.PHNI

CP000031.PHNI        Location/Qualifiers
FT   CDS_pept        476591..477682
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phnI"
FT                   /locus_tag="SPO0470"
FT                   /product="alkylphosphonate utilization protein PhnI"
FT                   /note="identified by similarity to SP:P16687"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0470"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93788"
FT                   /db_xref="GOA:Q5LW72"
FT                   /db_xref="InterPro:IPR008773"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LW72"
FT                   /protein_id="AAV93788.1"
FT                   /translation="MYVAVKGGERAIENAHAWLAEERRGDTSVAELSLAQIREQLSLAV
FT                   NRVMAEGSLYDPDLAALAIKQARGDLIEAIFLIRAYRTTLPRFGASRAVDTGAMACDRR
FT                   ISATFKDAPGGQVLGPTFDYTHRLLDFKLAAEGDVPPAPSAPPRREPTPHITEFLGQEG
FT                   LIQPEPVSDAVPGDLTREPLEFPADRALRLQSLARGDEGFVLGMAYSTQRGYARNHAFV
FT                   GELRIGRVTVEMEVPELGFAIEIGELELTECETVNQFKGSKTEPPQFTRGYGLVFGQSE
FT                   RKAISMALVDRALRWKELGEDNLGAPAQDEEFVLSHSDNIQATGFLEHIKLPHYVDFQS
FT                   ELELVRKLRREAEERIVHREAAE"
     atgtatgttg ccgtcaaagg gggcgagcgc gccatcgaga acgcccatgc ctggctggcc        60
     gaagagcggc ggggagatac gtcggtcgca gaactttccc ttgcccagat tcgcgaacaa       120
     ctgagccttg cggtgaaccg ggtgatggcc gagggctcgc tttatgatcc cgacctggcc       180
     gcgctggcga taaagcaggc gcgcggcgat ctgatcgagg cgatctttct gatccgcgcc       240
     tatcgcacca ccctgccgcg ctttggtgca agccgggcgg tggataccgg cgcgatggcc       300
     tgcgaccggc gcatctcggc cacgttcaag gacgcgcccg gcgggcaagt gctggggccg       360
     accttcgact acacccatcg cctgctggat ttcaaactgg ccgccgaggg cgacgttcca       420
     cccgcgccaa gcgccccccc gcgccgggaa cccacaccgc atatcaccga gttcctgggt       480
     caggaggggt tgatccagcc cgaacccgtg agcgacgcgg tgccgggcga cctgacccgc       540
     gagccgctgg aatttcctgc cgaccgcgcc ctgcgcctgc aatcgctggc gcgcggcgac       600
     gaggggtttg tgctgggcat ggcctattcc acccagcgtg gttatgcccg caaccacgcc       660
     tttgtgggcg aattgcgcat cgggcgggtc acggtcgaga tggaggtccc cgaactgggc       720
     tttgccatcg agatcggcga gttggagctg acggaatgcg agacggtcaa ccagttcaag       780
     gggtcaaaga ccgaaccgcc gcagttcacc cgcggttacg ggctggtctt tggccagtcc       840
     gagcgcaagg cgatctcgat ggcgctggtc gaccgcgccc tgcgctggaa ggagctgggc       900
     gaggacaatc tgggcgcccc ggcgcaggac gaggaatttg tgctgagcca tagcgacaac       960
     atccaggcga ccgggttcct ggagcatatc aagctgcctc attacgtcga tttccagtcg      1020
     gaactggaac tggtccgcaa gctgcgccgc gaggcggaag agcggatcgt gcatcgggag      1080
     gcggcggaat ga                                                          1092
//

If you have problems or comments...

PBIL Back to PBIL home page