(data stored in ACNUC7421 zone)

EMBL: CP000031.PHNJ

CP000031.PHNJ        Location/Qualifiers
FT   CDS_pept        477762..478598
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phnJ"
FT                   /locus_tag="SPO0471"
FT                   /product="alkylphosphonate utilization protein PhnJ"
FT                   /note="identified by similarity to SP:P16688"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0471"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93789"
FT                   /db_xref="GOA:Q5LW71"
FT                   /db_xref="InterPro:IPR010306"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LW71"
FT                   /protein_id="AAV93789.1"
FT                   /translation="MTEQAYNFAYLDEQTKRMIRRAILKGLAVPGYQVPFASREMPMPY
FT                   GWGTGGVQVSAATLTPDDRLKVIDQGADDTTNAVSIRKFFERTAGVATTEATQEATVIQ
FT                   TRHRIPEAELTEDQILVYQVPIPEPLRFLEPRETETRKMHSLQEYGLMHVKLYEDISQH
FT                   GAISTAYAYPVRVAERYVMDPSPIPKFDNPKMEMAAIQLFGAGREQRIYAVPPYTRVVS
FT                   LDFEDYPFEATKAEHPCDLCGAEDSYLDEVIMDDAGGRMFVCSDTDYCRSRREAAA"
     atgaccgagc aagcctataa ctttgcctat ctcgacgaac agaccaagcg gatgatccgc        60
     cgcgccatcc tcaagggact ggcggtgccg ggataccagg tgcccttcgc cagccgcgag       120
     atgccgatgc cctatggctg gggcaccggg ggcgtgcagg tctcggccgc gacgctgacg       180
     cccgatgacc ggttgaaggt gatcgaccag ggcgctgacg acaccaccaa cgcggtgtcg       240
     atccgcaagt tctttgagcg cacggcaggg gtggccacga ccgaggcaac gcaggaggcg       300
     acggtgatcc agacccgcca tcgcatcccc gaggcagagc tgaccgaaga tcagatcttg       360
     gtctatcagg tgccgatccc cgaaccgctg cgctttctgg aaccgcgcga gaccgagacc       420
     cgcaagatgc acagcctgca ggaatacggg ctgatgcatg tgaagctata cgaggatatc       480
     agccagcatg gcgcgatctc gaccgcctat gcctatccgg tgcgggtggc cgagcgctat       540
     gtgatggacc cctcgccaat ccccaagttc gacaacccca agatggagat ggcggcgatc       600
     cagctcttcg gagccgggcg cgagcagcgc atctatgcgg tgccgcccta tacccgcgtc       660
     gtaagtctcg atttcgaaga ctacccgttc gaggcgacca aggccgagca tccctgtgac       720
     ctgtgcggtg ccgaagacag ctatctggac gaggtgatca tggacgatgc gggcgggcgg       780
     atgttcgtct gttccgacac tgattactgc cggtcgcgcc gcgaggcggc ggcatga          837
//

If you have problems or comments...

PBIL Back to PBIL home page